SecReT6
Protein ID: 152995239
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1210
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1355932..1356609 [+]
Producthypothetical protein
NoteTssA
UniProt IDA6VUL0
KEGG IDmmw:Mmwyl1_1210
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 9.80E-11, Aligned region: 46..95
ImpA-rel_N [PF06812], Evalue: 9.80E-11, Aligned region: 94..104
Protein Sequence: 225 a.a.     [Download]
>gi|152995239|ref|YP_001340074.1| hypothetical protein Mmwyl1_1210 [Marinomonas sp. MWYL1]
MKNVIYIENRRFYIESDSSLIRDEELYCAIKDSINRRAALPKSNFDWQSVYSDAESLAESVGVDLIIASY
FTVAAFKTQGFRGLANGLTLINSALLNQNSHDLKQQKLNKGLVDWIRKEIIIDIGSMQPSYDAMRDLYRC
ERECQILDDVLGSQLEMNEGIFEEIALHLLQYIERLEMRYHRSEKVQERVVEELSKFSWNDTALVAAASL
ISAAFTFVVMLYWPK
 
Nucleotide Sequence: 678 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1355932-1356609 Marinomonas sp. MWYL1 chromosome, complete genome
ATGAAAAATGTAATTTATATCGAGAATAGGCGCTTTTATATAGAGTCTGACTCCAGTCTGATTCGAGATG
AAGAGCTGTACTGTGCTATCAAAGATAGTATTAATCGTAGAGCCGCTTTACCCAAAAGTAACTTTGATTG
GCAAAGTGTTTATTCAGATGCTGAGTCGCTGGCAGAAAGTGTTGGGGTTGATTTAATCATCGCCAGTTAC
TTTACCGTCGCGGCATTTAAAACTCAGGGCTTTCGTGGGTTGGCAAACGGTCTTACCTTAATCAACTCGG
CTTTATTAAATCAAAATAGCCATGATTTAAAACAGCAAAAGTTAAATAAAGGCTTAGTAGATTGGATTAG
AAAAGAAATCATCATAGATATAGGTAGCATGCAACCTAGCTATGACGCAATGCGAGACCTATATCGTTGT
GAGCGAGAATGCCAGATCTTAGATGATGTGCTAGGCAGTCAGCTGGAAATGAATGAAGGCATCTTTGAAG
AGATTGCATTGCATCTCCTGCAGTACATTGAGCGTCTTGAGATGCGGTATCACCGCAGTGAAAAAGTGCA
AGAGCGAGTGGTAGAAGAACTGTCAAAATTTTCTTGGAATGATACCGCGTTAGTGGCGGCTGCAAGTTTG
ATTAGTGCAGCATTTACTTTTGTTGTCATGTTGTATTGGCCGAAGTGA
 Primer design