SecReT6
Protein ID: 152995241
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1212
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1357553..1359652 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA6VUL2
KEGG IDmmw:Mmwyl1_1212
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.30E-64, Aligned region: 43..336
Phage_base_V [PF04717], Evalue: 1.70E-23, Aligned region: 375..467
DUF2345 [PF10106], Evalue: 0.0023, Aligned region: 579..623
Protein Sequence: 699 a.a.     [Download]
>gi|152995241|ref|YP_001340076.1| Rhs element Vgr protein [Marinomonas sp. MWYL1]
MATLTFTLALDGMEDNTLLVREYQGHESLSDSLLKDGSPCYGFRYQLALASRQSDLSADTIVDKNAELRV
FRNGELIQRVHGIVCHFEKGDTGHHFTYYGLTLVPALERLSLRHNSRIFQKQTAQDIISQLLNEMGITEH
LFDTQRTPLEREFCAQYRESDLDFVHRLAAEEGWVYYFTHEEGKHQLHFADQSQFLPKHPTPIPYNVLSG
GGSDDQYIATLTHHTQSLPSQAVLKDYSFKKPDYRFLHQEDGENLYYQLPNYEHYDAPGRFKDDVTGKAF
SRIRLEYLRRSARTLVGESNHAAIQAGLKITIEGHSEDSINQEWLPVSVEHHGTQPQVLEEEGQSGSTNY
HNRFTFIPATTNWQATPQPKPSVDGPMMAIVVGPEGEEIFCDEHGRIKLHFPWDRYSEANDHSSCWVRVS
QGWAGNQHGMMAIPRIGSEVIVSFLNGDPDQPIVTGRTFNAKNTPPYLLPDNKTKTVWRSDTHQGEGFNE
ISFEDQVDNEKVYIHAQKDMETDVLNDRITHIGHDQHGQIDNDRFTQIGGENGTGNDHLTIKGESRHKID
KDHTLMVDGSLQQKVGSKAVLDAGNEVHLSSGVKLVVDAGAELTLTAGGSFVKIDGSGVHLVGSAINLNS
GGSAGSGSGFGGAQAETPLNVVSPEYDANLEAPEGNEAPVVPVQQKQAIVTAAEQGTPICQACEEAATE
 
Nucleotide Sequence: 2100 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1357553-1359652 Marinomonas sp. MWYL1 chromosome, complete genome
ATGGCTACATTGACGTTTACACTGGCACTCGACGGCATGGAAGACAACACTCTGCTTGTCCGAGAATACC
AAGGGCACGAATCGCTCTCCGATTCCCTGCTAAAAGACGGCTCGCCTTGTTATGGCTTCCGTTACCAATT
GGCCCTCGCCAGCCGTCAATCGGATCTGTCTGCTGATACCATCGTCGATAAAAACGCCGAGCTACGCGTG
TTTCGTAACGGCGAACTGATTCAACGAGTGCACGGCATTGTTTGCCACTTTGAAAAAGGCGACACCGGAC
ACCACTTTACCTACTATGGCTTAACCTTGGTTCCGGCATTGGAACGCTTATCGCTACGTCACAACAGCCG
TATCTTCCAAAAGCAAACCGCGCAAGACATCATCAGCCAATTGCTGAATGAAATGGGCATCACCGAACAC
CTGTTTGATACCCAACGTACACCGCTTGAGCGCGAGTTCTGTGCCCAGTACCGAGAAAGTGACTTAGATT
TTGTCCACCGTTTGGCGGCCGAAGAAGGCTGGGTCTACTACTTCACCCACGAAGAAGGCAAACACCAACT
GCACTTTGCAGATCAAAGCCAGTTTTTACCCAAACACCCAACCCCGATTCCGTACAACGTCTTATCAGGT
GGGGGCTCAGACGATCAATACATCGCCACCCTGACGCACCATACACAAAGCTTGCCTAGCCAAGCTGTGC
TCAAAGACTACAGCTTCAAAAAGCCCGACTACCGCTTCTTGCACCAAGAAGACGGCGAGAACCTATATTA
CCAGCTGCCAAACTACGAACACTACGATGCCCCTGGGCGTTTTAAAGACGACGTTACAGGCAAAGCCTTT
TCACGTATCCGTCTAGAATATCTACGTCGCAGTGCGCGAACCTTAGTAGGAGAAAGCAACCACGCCGCCA
TCCAAGCGGGCCTAAAAATCACCATCGAAGGCCACAGCGAAGACAGCATCAACCAAGAATGGCTGCCCGT
CTCGGTTGAACATCACGGCACCCAGCCGCAAGTCTTGGAAGAAGAAGGCCAATCTGGCAGCACAAACTAC
CACAACCGGTTTACCTTCATCCCAGCCACCACCAACTGGCAAGCGACACCGCAACCCAAACCCAGTGTCG
ATGGCCCCATGATGGCCATTGTAGTGGGACCCGAAGGGGAAGAAATCTTCTGTGATGAACACGGACGCAT
CAAACTGCACTTCCCATGGGACCGATACAGCGAAGCCAACGACCACAGCTCCTGCTGGGTACGTGTCTCC
CAAGGCTGGGCTGGCAACCAACATGGCATGATGGCGATCCCAAGAATCGGCAGCGAAGTCATCGTCAGCT
TTTTAAATGGCGACCCCGATCAACCGATCGTGACCGGACGTACCTTTAACGCCAAAAACACCCCGCCGTA
CCTTCTACCGGACAATAAAACCAAAACCGTCTGGCGCAGCGATACCCACCAGGGTGAAGGCTTCAACGAG
ATCAGCTTCGAAGACCAAGTCGACAACGAAAAAGTCTACATCCACGCGCAAAAAGACATGGAAACCGATG
TACTTAACGACCGCATCACCCACATCGGCCACGACCAACACGGACAAATCGACAACGACCGCTTCACCCA
AATCGGCGGAGAAAACGGCACAGGCAATGACCACCTGACCATCAAAGGCGAAAGTCGTCACAAGATAGAT
AAAGATCACACGCTGATGGTAGACGGAAGTCTGCAACAGAAAGTTGGCTCGAAAGCCGTACTGGATGCAG
GCAACGAAGTACATCTAAGCAGCGGTGTGAAACTGGTCGTTGATGCAGGCGCCGAACTCACCTTAACGGC
AGGGGGCAGCTTCGTAAAAATAGATGGCTCAGGCGTACACCTCGTCGGCTCGGCCATCAATCTAAACTCC
GGCGGCAGCGCAGGATCGGGCAGTGGCTTTGGCGGGGCACAAGCGGAAACACCGCTAAATGTGGTTTCAC
CTGAGTACGACGCTAACCTTGAAGCGCCTGAGGGGAATGAGGCACCGGTTGTTCCGGTTCAGCAAAAACA
AGCCATAGTCACCGCCGCAGAGCAGGGCACTCCTATTTGTCAGGCTTGTGAAGAGGCGGCAACAGAATGA
 Primer design