SecReT6
Protein ID: 153947566
SecReT6 ID220
T6SS typei1
Gene symbol-
Locus tagYpsIP31758_0326
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]377928..381461 [+]
Productlipoprotein
NoteTssM
UniProt IDA7FDJ2
KEGG IDypi:YpsIP31758_0326
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.30E-89, Aligned region: 507..822
ImcF-related_N [PF14331], Evalue: 1.40E-69, Aligned region: 201..455
DUF1215 [PF06744], Evalue: 4.80E-39, Aligned region: 309..323
DUF1215 [PF06744], Evalue: 4.80E-39, Aligned region: 916..1035
DUF4131 [PF13567], Evalue: 0.00069, Aligned region: 15..93
DUF4131 [PF13567], Evalue: 0.00069, Aligned region: 444..477
MMR_HSR1 [PF01926], Evalue: 0.0036, Aligned region: 133..273
Protein Sequence: 1177 a.a.     [Download]
>gi|153947566|ref|YP_001399320.1| lipoprotein [Yersinia pseudotuberculosis IP 31758]
MKLPFFIRIAKPAIPRLKASIPVVLALMACAALIWVWIYGPEWQLGENYPFETLLSRWLVTAVFVLVAVC
WLSLKVMRRVQHLEKLQLQTKIQLDDPVSADIEQQNHYLNGWKHQLQRHLNTPEYLYHLPWYMVIGARNS
GKSTLIKEGYKLTEISASERLHVEGAADLRVRCWLGEQAVIIDPAGVLIEQPTTPIAGKASLNSRLWQSL
LSWLIEQRQRQPLNGIILTVDLHQMMTANKAQRETYVADIHQRLQEIRLSLHSQVPLYVVFTKMDLLYGF
EAMYQSLDKAEREAVLGVTFSLNAADPDVWRTELKQFWQQWVAQLNGAMPDMMLNSVDAGQRSQLFSFTR
QMQGLHDYVVQLLEGILYRGEHAQPLLRGVYLTSAQQRGQMDDIFTQSAAVQYHLAPQAFPTWPVSDTTP
YFTKALFNQVLLAEPNLAGENGIWLQKTRKRMFIFSGVGALAALTLWGYWHYYHQLNYRAGEEVLTQAKT
FLSIPPPEGDDRYGNLQLPLLNPIRDATLAYGNYHERSPFLADMGLYQGNNIGPYVESTYLQLLQQRFVP
ALMSGLLEQLNAAPKGSEEKLEILRVMRMLEDGSGRNAALVEQYMSHRWSQQFNGQRELQEQLSSHLNYA
LKHTDWHGARESGDQYAIKSFVPYLSPIQSAQQELSKLSIYQRVYQNLRIKAQDALPPALDLRDQIGASF
DDIFVSGNDRLLVIPQFLTRSGLQSYFIKQNDQLVDLTVMDSWVLNLTKNVEYSEADRKEIHRQVTEQYL
GDYTATWRAAMNNLSVSDFEGLPQAISAIEQVISGEQPFRRALQTLSDNTRLPVISDLIPAKEQQELLQK
PDYLLLTRINREFSPETAVLVENGDKGSVIQSVYQKLTELHRYLLAIQNSPAPGKAALKAVQLRLDQNNS
DPIFEVQQLAKNLPEPLNRWVGELAEQAWRVVMMEAIQSLEVEWNETVIKQYQTYLAGRYPFDPHAKQDV
PLSEFERFFGPKGTLDAFYQQNLKPFVENNLTGGSDGELLIRPDVLQQLAQARKIRDTFFSAQNGLGTQF
AIEPVLLSGNKRRSVLNLDGQLLDYAHGRSGVVHLVWPNSMRAGVESKLTLVPDESGKSPRTLSFSGPWA
QLRLINAGELTNVGTNSFDVRFKVDGGEMTYRIFVDESDNPFAGGLFSKFSLPDTLY
 
Nucleotide Sequence: 3534 bp     [Download]
>gi|153946813|ref|NC_009708.1|:377928-381461 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAAATTGCCGTTCTTTATACGCATAGCCAAGCCCGCCATTCCTCGCCTTAAAGCGTCAATACCGGTGG
TATTGGCGTTGATGGCTTGTGCGGCACTCATTTGGGTATGGATTTACGGACCCGAGTGGCAATTGGGGGA
AAATTACCCGTTTGAGACATTATTGAGCCGTTGGTTGGTCACGGCGGTATTTGTCTTGGTGGCCGTTTGT
TGGCTCAGCCTGAAAGTCATGAGGCGAGTACAACACCTGGAAAAACTCCAACTGCAAACGAAAATTCAGC
TCGACGACCCCGTCAGTGCTGATATCGAACAACAAAACCACTACCTCAATGGCTGGAAGCACCAACTTCA
GCGCCATTTGAACACCCCGGAATATCTGTATCACCTGCCCTGGTACATGGTCATTGGTGCGCGCAATAGC
GGCAAAAGTACACTGATCAAAGAAGGGTATAAACTGACAGAGATCTCCGCATCCGAGCGGCTCCATGTGG
AAGGCGCAGCAGATCTGCGCGTCCGCTGCTGGTTGGGGGAACAAGCGGTTATTATCGATCCTGCGGGGGT
GCTGATTGAACAACCTACGACACCGATCGCGGGCAAAGCATCACTCAACAGCCGCTTATGGCAAAGTCTA
TTATCCTGGCTGATTGAACAGCGCCAGCGTCAGCCGCTAAACGGCATTATTCTCACCGTCGATCTTCATC
AGATGATGACCGCGAATAAAGCGCAGCGGGAGACGTACGTCGCTGATATTCATCAACGGCTGCAAGAGAT
ACGGCTGTCTTTGCACAGCCAGGTGCCGCTGTATGTGGTGTTCACCAAAATGGACCTGCTGTACGGCTTC
GAGGCCATGTACCAATCGCTGGATAAAGCCGAACGTGAAGCGGTTCTGGGGGTGACGTTCAGCCTCAATG
CGGCGGATCCGGACGTGTGGCGGACGGAGTTGAAACAGTTCTGGCAGCAATGGGTCGCACAACTGAATGG
CGCGATGCCGGACATGATGCTGAACAGTGTGGATGCCGGGCAGCGTAGCCAGTTGTTTAGCTTCACTCGC
CAGATGCAGGGCCTGCACGATTACGTCGTGCAACTGCTGGAAGGCATTCTGTACCGTGGAGAACATGCCC
AGCCGCTGTTACGGGGGGTTTATCTCACGTCTGCCCAGCAACGCGGGCAAATGGACGATATCTTTACCCA
ATCTGCCGCGGTGCAATATCACCTTGCGCCACAGGCCTTCCCGACCTGGCCGGTCTCGGATACGACGCCG
TATTTTACCAAAGCGCTGTTTAATCAGGTGCTGTTGGCCGAACCCAATCTGGCCGGAGAGAACGGTATCT
GGCTGCAAAAAACGAGAAAGCGAATGTTCATTTTCTCGGGGGTGGGTGCCCTGGCCGCGCTGACCTTATG
GGGCTACTGGCACTACTATCACCAGCTTAACTACCGGGCTGGCGAAGAGGTATTAACCCAGGCAAAAACC
TTCTTATCGATCCCACCGCCAGAAGGCGATGACCGTTATGGCAATCTGCAACTGCCGCTGCTAAACCCCA
TCCGTGACGCCACGCTGGCTTACGGTAATTACCATGAACGCAGCCCGTTCCTGGCGGATATGGGGTTATA
TCAGGGCAATAATATCGGGCCTTATGTCGAAAGCACTTACTTGCAACTCCTACAGCAACGTTTTGTCCCG
GCACTGATGAGCGGGCTGTTGGAACAACTGAACGCCGCACCGAAGGGCAGTGAAGAGAAACTGGAAATTC
TGCGGGTGATGCGGATGTTGGAAGACGGCAGTGGCCGCAATGCCGCGCTGGTTGAACAATATATGAGCCA
CCGCTGGAGCCAACAATTCAACGGCCAGCGCGAGTTGCAGGAGCAACTGTCGAGCCACCTGAACTACGCA
CTGAAACACACCGACTGGCACGGCGCACGGGAAAGTGGCGATCAATATGCGATCAAGAGCTTTGTCCCGT
ACCTCAGCCCGATCCAGTCAGCGCAGCAAGAGTTGAGTAAACTCTCGATCTACCAACGGGTGTATCAGAA
CCTGCGGATCAAAGCACAGGATGCGTTGCCGCCCGCGCTCGATTTGCGCGATCAGATCGGCGCAAGTTTT
GACGACATCTTTGTCTCCGGTAACGATCGCCTGCTGGTGATCCCGCAATTCCTGACCCGTAGCGGCTTAC
AGAGTTACTTCATCAAACAGAACGATCAACTGGTTGATCTCACGGTGATGGACAGTTGGGTACTTAATCT
CACCAAGAACGTCGAATACAGCGAGGCAGACCGCAAAGAGATCCATCGCCAGGTGACCGAACAGTATCTT
GGCGATTATACCGCCACCTGGCGTGCGGCCATGAATAACCTATCGGTCAGTGATTTTGAAGGCTTGCCAC
AGGCGATCAGCGCCATTGAACAGGTGATCAGCGGGGAACAACCTTTCCGCCGTGCACTGCAAACGCTGAG
TGACAACACCCGCTTGCCGGTTATCTCGGATCTGATCCCCGCGAAGGAGCAGCAAGAGCTGCTGCAAAAA
CCCGATTACCTGCTGCTGACCCGCATCAACCGTGAGTTCTCCCCCGAAACGGCGGTGCTGGTGGAGAATG
GCGATAAAGGCAGCGTGATCCAAAGTGTTTACCAAAAACTGACCGAGCTACACCGCTATCTGTTGGCGAT
CCAAAACTCGCCCGCGCCGGGCAAAGCGGCGTTGAAGGCGGTGCAATTACGTCTGGATCAAAACAACAGT
GATCCGATTTTCGAAGTCCAGCAACTGGCTAAAAACCTACCGGAGCCGCTAAACCGCTGGGTGGGCGAAC
TGGCAGAGCAAGCCTGGCGGGTGGTGATGATGGAGGCGATCCAGTCACTGGAAGTGGAGTGGAATGAGAC
GGTGATCAAACAGTATCAAACCTACCTGGCCGGACGTTATCCCTTCGATCCTCACGCGAAACAGGATGTA
CCACTCAGTGAGTTTGAACGCTTCTTCGGGCCGAAAGGCACGCTCGATGCATTCTATCAGCAGAACCTGA
AACCGTTTGTCGAAAACAACCTGACCGGTGGCAGCGATGGCGAATTGCTGATCCGGCCTGATGTGTTACA
GCAACTGGCGCAGGCGCGGAAAATTCGCGACACCTTCTTCTCGGCCCAAAACGGCCTGGGCACACAGTTT
GCGATTGAACCGGTGCTGTTAAGTGGCAACAAGCGCCGCAGCGTATTGAATCTGGATGGGCAATTACTGG
ATTACGCCCATGGCCGCAGCGGCGTAGTGCATCTGGTTTGGCCAAACTCGATGCGTGCAGGAGTGGAAAG
CAAACTGACGTTAGTCCCGGATGAGAGCGGCAAATCACCGCGCACCCTCAGCTTCAGCGGTCCTTGGGCG
CAGTTGCGGCTGATCAACGCCGGTGAACTGACCAATGTGGGCACCAACTCCTTCGATGTCCGCTTCAAGG
TTGATGGCGGCGAGATGACGTACCGCATCTTTGTTGATGAATCCGACAACCCATTCGCGGGCGGTTTGTT
CAGTAAATTCAGTCTGCCAGACACTTTGTATTAA
 Primer design