SecReT6
Protein ID: 153948721
SecReT6 ID225
T6SS typei3
Gene symbol-
Locus tagYpsIP31758_3437
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]3873235..3874248 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA7FMB4
KEGG IDypi:YpsIP31758_3437
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.20E-08, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 3.20E-08, Aligned region: 183..203
Protein Sequence: 337 a.a.     [Download]
>gi|153948721|ref|YP_001402392.1| ImpA domain-containing protein [Yersinia pseudotuberculosis IP 31758]
MILKRMDNNMSDIFPQALFGVEYDPAYGEIESILSQLDESADPLSRPHEPPQINWHHISEQANKLLEQCF
DLRVMLWFIRANIHIKGISALYDGFMRINAQTQDTDVVIYPQSEEPPLNSGHAAALGWLSTAQCIAELKT
ARLTEEHPYILQDLITTEALPNGQERYFVTSSTLFLTVNNYFQQNGLPDLKDQLTKVDMLLEQIESYANQ
STESYQLHCEQLRIFLKNNISQLAQLNAPEHDDPETVYQKIDSHESLDTQSFNSNDKSIRSRQEIIMMLD
RILEYFQHYEPSHPAPIFIRRTKEMIGMDFYSIVEEILPEAVITLKQFTGKTNLPFR
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c3874248-3873235 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
TTGATTTTAAAACGGATGGACAATAATATGAGTGACATATTTCCTCAAGCATTATTCGGCGTTGAATATG
ATCCGGCCTATGGCGAGATTGAGTCCATCCTCTCTCAATTAGATGAGTCTGCGGACCCCCTTTCCCGCCC
GCATGAACCCCCTCAAATAAACTGGCACCATATCAGTGAGCAAGCCAATAAGCTGCTAGAACAATGTTTT
GATTTACGTGTAATGCTTTGGTTTATAAGGGCAAATATTCATATAAAAGGAATCTCGGCCCTCTATGATG
GCTTTATGCGCATTAATGCACAAACCCAAGATACTGATGTTGTTATCTACCCTCAATCGGAAGAACCGCC
ATTAAATAGTGGGCATGCCGCCGCATTAGGTTGGTTATCTACAGCACAATGTATTGCAGAGCTTAAGACT
GCACGCCTTACAGAAGAGCACCCTTACATTTTACAAGATCTTATTACGACTGAAGCGTTACCCAATGGTC
AAGAGAGATATTTTGTTACATCTTCGACATTATTTTTAACTGTCAATAATTATTTCCAACAGAATGGATT
GCCAGATTTAAAAGACCAATTGACAAAAGTAGATATGTTGTTGGAACAAATTGAGTCCTATGCAAATCAA
TCCACAGAGAGTTACCAACTGCATTGTGAACAATTACGTATTTTCTTAAAAAATAATATTTCTCAGCTTG
CACAATTGAATGCCCCAGAACATGACGATCCCGAAACTGTTTATCAAAAAATAGACAGTCATGAATCTCT
TGATACTCAGTCCTTTAATTCAAATGATAAGAGCATTCGCTCACGGCAAGAGATCATTATGATGCTGGAC
CGTATTCTAGAGTATTTTCAACATTATGAGCCTAGTCATCCAGCCCCAATATTCATTCGCCGTACCAAAG
AGATGATAGGTATGGATTTTTATTCCATTGTTGAAGAAATTCTGCCTGAAGCTGTAATTACATTAAAACA
GTTTACCGGAAAAACTAACCTACCGTTTCGATGA
 Primer design