SecReT6
Protein ID: 153948858
SecReT6 ID225
T6SS typei3
Gene symbol-
Locus tagYpsIP31758_3425
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]3857702..3858067 [-]
Producthypothetical protein
NotePAAR
UniProt IDA7FMA2
KEGG IDypi:YpsIP31758_3425
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 1.70E-20, Aligned region: 18..107
PAAR_motif [PF05488], Evalue: 0.0028, Aligned region: 66..120
Protein Sequence: 121 a.a.     [Download]
>gi|153948858|ref|YP_001402380.1| hypothetical protein YpsIP31758_3425 [Yersinia pseudotuberculosis IP 31758]
MTAANTRAGGISFIGSDPMIPISAPNTAPNANGIPNVSNYFCCGGNEQNLNTIRPATIDGGSVMGAASGT
HSAKMDPMQGSGKYFIQGSPATRLGDMSMTNNYNAPSTQIAPSQTKYFVNA
 
Nucleotide Sequence: 366 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c3858067-3857702 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGACAGCAGCCAATACTCGCGCAGGTGGGATCAGCTTTATCGGCAGTGACCCGATGATCCCGATATCTG
CTCCCAACACCGCGCCCAACGCCAATGGTATTCCTAATGTCAGCAACTATTTTTGCTGTGGGGGTAACGA
ACAGAATCTCAACACCATCCGTCCAGCCACGATAGACGGCGGATCTGTGATGGGGGCGGCCTCGGGGACA
CATTCGGCCAAGATGGACCCTATGCAGGGATCAGGAAAGTATTTCATTCAGGGAAGCCCAGCAACACGTT
TAGGAGATATGAGTATGACCAATAATTACAACGCGCCTTCGACGCAAATTGCGCCCAGCCAGACCAAGTA
TTTTGTCAATGCGTAG
 Primer design