SecReT6
Protein ID: 153949071
SecReT6 ID225
T6SS typei3
Gene symbol-
Locus tagYpsIP31758_3435
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]3871153..3872655 [-]
Producthypothetical protein
NoteTssC
UniProt IDA7FMB2
KEGG IDypi:YpsIP31758_3435
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.90E-184, Aligned region: 66..492
Protein Sequence: 500 a.a.     [Download]
>gi|153949071|ref|YP_001402390.1| hypothetical protein YpsIP31758_3435 [Yersinia pseudotuberculosis IP 31758]
MQKAQLNDTPDINVDLAENELDDILKRSFRPRTDEASATVRRAIGTLAAYANKGQVKVNRDVVLTIESLV
AEIDEKLSDQMNLILHHKEFQKLESAWRGLSYLVDNTDANETLKIRVLNISQDELGKTLRRYRGSAWDQS
PIFKQVYEHEYGQFGGEPFGCMIGDYEFDHSPQSVALLTELAKVAAAAHCPFITSSSPSIMQMNNWRELG
NPRDIGKIFTTPEYAPWRRLRESNDSRYLVLTLPRFLSRLPYGAKNHPIDDFAFEEVVSPHASEDFTWAN
AAYAMGVNINRAFNEYGWCSRIRGIESGGSVEELPAYAFPSDEGGYELTCPTELAISDRRENELSNAGFL
PLVYRKNSDFAAFIGSCTLHAPANYDDPDATANARLSARLPYIFATCRFAHYLKCIVRDKIGSFRSRDDM
QLWLNDWVMNYVDGDPSISTEATKAKRPLAAAEVQVEDVEDDPGFYRAHFYLRPHYQLEGMTVSLRLVSK
LPSNKESEKK
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c3872655-3871153 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGCAGAAAGCCCAACTCAATGACACGCCAGACATCAACGTCGATCTGGCTGAAAACGAGTTAGATGACA
TTTTAAAACGTTCTTTTCGCCCTCGAACTGACGAAGCTTCCGCCACAGTGCGCCGTGCCATAGGCACGCT
TGCTGCGTATGCCAATAAAGGCCAAGTGAAAGTCAATCGTGATGTCGTACTGACCATTGAGTCTTTAGTC
GCTGAAATTGACGAAAAACTTTCCGATCAAATGAACCTTATTCTGCACCATAAAGAGTTCCAAAAGCTGG
AATCAGCTTGGCGCGGGCTTAGCTATCTTGTTGATAATACAGATGCTAATGAAACTTTAAAAATACGGGT
ACTGAACATTAGCCAAGATGAACTGGGGAAAACGCTTCGCCGTTATCGTGGCTCTGCATGGGATCAAAGT
CCGATATTTAAACAGGTCTATGAACATGAATATGGGCAGTTTGGTGGGGAACCTTTTGGTTGCATGATCG
GTGATTATGAATTCGATCACAGTCCACAGAGTGTGGCTCTGCTGACCGAGTTAGCCAAGGTGGCCGCCGC
CGCTCACTGTCCTTTCATTACCTCTTCTTCCCCAAGCATCATGCAGATGAATAACTGGAGGGAGCTGGGT
AACCCAAGGGATATCGGCAAAATTTTTACCACACCTGAATATGCGCCATGGAGACGTTTACGTGAGAGTA
ATGACTCCCGCTATCTGGTACTGACTCTGCCACGTTTTCTTTCGCGTCTGCCGTATGGTGCCAAAAATCA
TCCTATTGATGATTTTGCTTTTGAAGAAGTGGTTAGCCCTCATGCCAGTGAGGATTTCACTTGGGCGAAT
GCGGCCTATGCCATGGGCGTCAATATTAACCGGGCCTTCAATGAATATGGTTGGTGTTCAAGGATCCGCG
GTATTGAGTCGGGGGGGTCCGTAGAAGAACTTCCGGCCTATGCTTTTCCTTCTGACGAAGGCGGATATGA
ACTCACTTGTCCGACAGAATTGGCAATTTCGGACCGTCGTGAGAACGAGCTATCCAATGCTGGTTTTTTA
CCGCTGGTCTACCGTAAGAACTCAGACTTTGCCGCCTTTATCGGGTCGTGCACCCTGCATGCACCGGCAA
ACTATGATGACCCCGATGCGACGGCGAACGCCAGATTATCGGCCCGTTTACCTTACATTTTTGCCACCTG
TCGTTTCGCCCATTACCTCAAATGTATTGTGCGCGACAAAATTGGTTCGTTCCGCTCGCGGGATGACATG
CAACTTTGGCTTAACGACTGGGTGATGAACTACGTCGATGGTGACCCCTCCATTTCAACAGAAGCCACTA
AAGCTAAACGCCCGCTGGCCGCTGCGGAAGTTCAAGTTGAAGACGTAGAGGATGATCCTGGTTTTTACCG
CGCTCACTTCTATTTACGCCCTCACTACCAACTTGAAGGTATGACGGTTTCTCTGCGGCTGGTTTCTAAA
CTTCCATCCAACAAGGAAAGCGAAAAGAAATAA
 Primer design