SecReT6
Protein ID: 153949294
SecReT6 ID225
T6SS typei3
Gene symbol-
Locus tagYpsIP31758_3421
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]3850633..3854127 [-]
Producthypothetical protein
NoteTssM
UniProt IDA7FM98
KEGG IDypi:YpsIP31758_3421
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 8.00E-75, Aligned region: 498..796
DUF1215 [PF06744], Evalue: 5.20E-30, Aligned region: 905..1024
ImcF-related_N [PF14331], Evalue: 3.60E-29, Aligned region: 95..114
ImcF-related_N [PF14331], Evalue: 3.60E-29, Aligned region: 194..375
Protein Sequence: 1164 a.a.     [Download]
>gi|153949294|ref|YP_001402376.1| hypothetical protein YpsIP31758_3421 [Yersinia pseudotuberculosis IP 31758]
MIRRMLILIIALVLCYIVWWIGPLIAIGPYFPLGGVWVRKIIIALILFWALWPFVAIFFSWIFRYARAPL
PKRKKKTVQLDRVSARFHDAMLTLQHADLSSQKTRWQRWRQRRKRQYIDAKPWFLVMGPPGCGKTSIVYE
SSEKFLLSEQYGLAQTTDIGPTQDCNWWLTDRAVYIDTAGEWILLHGQSEEAGTARQKLFSMIRKYRRYP
GVDGIVLCLDVSVLLNSSVTERKSLADTLRLRILEVASTFQADIAVYLFLNNIDKLPGGETFLSLMNDEL
LAGGLGISMTHNEKGQNNFVADEERYRELLTRVSRYVLEILHDSPNMEMRHQLLLFTESLGALQKPLFGL
FEQIFPATPIGYTGCLRQFWFGSTQNLTSWEALYYPSSTSTFESRPAGQMYFPALSQAITERGVLHATGP
MPLRNRLLNIGKYVFVVLVLCILLLMLSARYFWEYDYIGYATARFEETRRIVRDIPITNQVNDNLVAAYE
QLGYINTHYLESSPPLLTPYFEHRLLNQAMLQTYHRHLNKVFWPAVQNYVTNELKKDTQSPDGDNYDTLK
VYLMLGQPDHRSQEALVQWFMSRWESFAPQGYGQNDRKLFSYHLSELFSDTASAAPKVKLNDELIRESRI
KAMKTPIHIRVINRIHDAPLPARIEDLSLADAAGPSVTLMLRRKSPSTVTDLAIPAFYTRASYHDVVNPQ
LQEASEAMINEEAWVLSDGKASVSQVSLLAAAQKLSDEARKYYLMEYANQWDAFFNDIRVRPINGLDDAA
LLARQLSDPSSPLANLVRFSTREITLTTDNNGKGAMSSGWFSIQRNKLTTARRSIIDEMSGERSRFRLTP
EKAVEDRFELLRRLGYALQSASTSNSDPLGRTFEQIYNQLITLSTSLRAGQILPQNNDFSRLQIDMARQP
EPVRSIMMDLLAVGQTQSLQQSKANLSKGVSSIASDLCSNAVSGRYPFNRLASEEIGIGDFNRMFGRSGA
MQSFFDQNLAPYVDTNGNRWKVKPDSNGVVTPKTLRSFENSAQIRDTFFDASGKMAMSMIIRPISLTPSI
LEAVLDVDGQIINYSHGSNQPVKVDWPGPKGGVYIRLTFKTQDGNVETVSFNGPWAIFRMYDVSNPRPLG
VNSRELMMVMDNVSGVFKIELSSTMKDYPLWSKALAQFSCPKNL
 
Nucleotide Sequence: 3495 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c3854127-3850633 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGATACGCAGAATGTTGATTTTAATCATTGCCCTAGTGCTTTGTTATATTGTGTGGTGGATAGGGCCGC
TGATCGCCATTGGCCCCTATTTCCCTCTGGGGGGGGTATGGGTTCGTAAGATCATTATTGCTCTGATTTT
ATTTTGGGCACTGTGGCCATTTGTTGCAATTTTCTTCAGTTGGATTTTTCGTTATGCCCGTGCGCCACTT
CCCAAGCGCAAGAAAAAAACGGTTCAGCTTGATCGCGTTTCTGCACGTTTTCATGATGCGATGCTCACCC
TGCAACATGCGGATCTTTCAAGCCAGAAAACACGCTGGCAGCGCTGGCGTCAACGGCGTAAGCGCCAGTA
TATCGATGCTAAACCGTGGTTTCTGGTCATGGGGCCACCCGGATGCGGTAAAACGTCGATAGTTTATGAG
AGTAGCGAGAAGTTCCTACTCTCAGAACAGTATGGTTTAGCGCAGACCACGGATATTGGACCGACGCAGG
ACTGTAATTGGTGGCTGACGGATCGTGCTGTTTACATCGATACGGCAGGGGAATGGATCCTGCTGCATGG
TCAGAGCGAAGAAGCGGGCACGGCTCGGCAAAAATTGTTCTCTATGATCCGCAAATATCGCCGTTATCCG
GGGGTTGATGGGATTGTTCTTTGCCTTGACGTCAGCGTGCTTTTGAACTCTTCGGTGACGGAACGTAAGT
CACTGGCTGATACGTTGCGTCTGCGGATCCTGGAAGTTGCCTCGACATTTCAGGCCGATATTGCGGTGTA
CTTGTTCCTCAACAATATCGATAAGTTACCTGGCGGCGAAACCTTCCTCTCGCTAATGAACGACGAACTT
CTGGCCGGAGGGCTTGGGATTAGCATGACCCATAATGAAAAGGGTCAGAACAATTTCGTTGCCGATGAAG
AACGTTACCGTGAACTCCTGACACGTGTTAGCCGTTATGTGTTGGAAATACTGCACGATTCGCCCAATAT
GGAGATGCGCCACCAATTGCTGCTGTTTACAGAAAGCCTGGGAGCGCTACAAAAACCCCTGTTTGGCTTA
TTCGAACAAATATTTCCGGCGACACCGATTGGCTATACCGGTTGTTTGCGGCAGTTCTGGTTTGGCAGTA
CCCAAAATCTGACCTCATGGGAGGCGCTGTATTATCCATCATCGACCAGCACCTTTGAAAGCCGGCCTGC
TGGGCAGATGTATTTCCCTGCACTGAGTCAAGCGATCACCGAAAGGGGGGTATTACACGCCACCGGCCCC
ATGCCTTTGCGAAATCGCCTGTTAAACATCGGTAAGTATGTGTTCGTGGTCCTTGTGCTCTGCATCTTAT
TGTTGATGCTGAGCGCCCGCTATTTTTGGGAATATGACTATATTGGCTATGCGACAGCTCGGTTTGAGGA
AACCCGTCGGATTGTGCGTGACATCCCAATCACGAATCAGGTCAACGATAATCTGGTCGCAGCTTACGAA
CAGTTGGGGTATATCAACACCCATTATCTGGAAAGTTCTCCGCCCCTGCTGACACCGTACTTCGAGCACC
GTTTACTGAATCAGGCGATGTTGCAAACCTACCATCGTCACCTGAATAAAGTGTTCTGGCCTGCGGTACA
AAACTACGTCACCAACGAGCTGAAAAAGGACACTCAATCTCCTGACGGTGACAACTATGACACGCTGAAA
GTTTACCTGATGCTCGGACAACCTGATCACCGCTCTCAGGAGGCATTGGTGCAATGGTTTATGTCGCGCT
GGGAAAGTTTTGCGCCTCAGGGATATGGGCAAAACGACCGCAAACTCTTCAGTTATCATTTGAGTGAACT
GTTTTCTGACACCGCCTCAGCTGCCCCGAAAGTTAAGCTGAATGATGAGCTGATCCGTGAATCACGCATT
AAAGCGATGAAAACACCGATACACATCCGGGTGATTAATCGTATTCATGACGCCCCACTGCCCGCGAGGA
TTGAGGATCTTAGTCTGGCGGATGCCGCCGGTCCTAGCGTAACACTGATGCTGAGACGTAAAAGCCCCAG
TACAGTAACGGATTTGGCGATCCCGGCTTTCTACACTCGGGCCAGCTACCACGATGTGGTTAACCCACAA
CTTCAGGAAGCATCGGAAGCGATGATTAACGAGGAAGCGTGGGTGTTGAGTGACGGTAAAGCTTCGGTTA
GTCAGGTTAGTTTACTGGCTGCGGCGCAAAAACTGTCCGATGAAGCGCGCAAGTATTATCTGATGGAGTA
TGCCAACCAATGGGATGCATTCTTCAATGATATCAGGGTGCGCCCAATCAACGGACTTGATGATGCGGCG
CTGCTGGCAAGGCAACTCTCAGACCCGTCATCCCCGTTGGCTAATCTGGTGCGTTTCTCCACACGGGAAA
TAACCCTAACCACTGATAATAATGGTAAAGGGGCGATGTCATCAGGTTGGTTCAGTATTCAGCGTAATAA
ACTCACGACTGCCCGTCGTAGCATCATTGACGAAATGTCGGGTGAGCGTTCTCGTTTTCGTCTGACGCCA
GAGAAAGCGGTGGAGGATCGCTTTGAACTGCTAAGACGTCTGGGATATGCCCTGCAAAGTGCGTCTACCA
GCAATTCTGATCCGTTGGGCCGAACCTTCGAGCAGATTTATAACCAGTTGATAACACTCTCGACCTCCCT
TCGGGCTGGGCAGATTTTGCCGCAAAATAACGATTTCAGTCGCTTGCAAATCGATATGGCCCGTCAGCCA
GAGCCGGTGCGCAGCATTATGATGGATCTGCTGGCCGTCGGACAAACGCAAAGTCTGCAACAAAGTAAGG
CCAACCTCAGCAAGGGCGTCTCTTCAATTGCTTCTGATTTATGTAGCAACGCCGTCAGTGGCCGTTATCC
CTTTAATCGGTTGGCTAGCGAAGAGATAGGTATTGGCGATTTCAACCGTATGTTTGGTCGTTCTGGGGCG
ATGCAAAGCTTCTTTGATCAGAATCTCGCACCGTATGTCGATACCAACGGCAACCGCTGGAAGGTAAAAC
CTGACAGTAACGGTGTGGTGACCCCTAAAACTCTGCGTTCGTTTGAAAACTCAGCACAAATCCGCGACAC
CTTCTTTGATGCCTCCGGCAAGATGGCGATGTCGATGATCATTCGCCCTATCTCACTGACTCCATCAATT
TTGGAAGCGGTTCTTGATGTCGATGGCCAGATTATTAACTACAGCCATGGTTCTAACCAACCGGTAAAAG
TTGATTGGCCAGGACCGAAAGGTGGGGTGTATATCCGCCTGACGTTCAAAACTCAGGATGGAAATGTGGA
AACCGTTAGCTTCAATGGTCCGTGGGCTATTTTCCGCATGTATGACGTTAGTAACCCTAGGCCACTCGGG
GTCAATAGCCGTGAACTCATGATGGTGATGGATAACGTGAGTGGCGTCTTCAAAATTGAGTTGAGTTCCA
CCATGAAAGATTATCCGCTGTGGTCAAAAGCATTGGCACAGTTCTCATGTCCTAAGAATCTCTAA
 Primer design