SecReT6
Protein ID: 153949405
SecReT6 ID225
T6SS typei3
Gene symbol-
Locus tagYpsIP31758_3430
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]3864496..3867099 [-]
ProductAAA ATPase
NoteTssH
UniProt IDA7FMA7
KEGG IDypi:YpsIP31758_3430
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.00E-33, Aligned region: 230..252
AAA_2 [PF07724], Evalue: 4.00E-33, Aligned region: 600..767
AAA [PF00004], Evalue: 3.50E-20, Aligned region: 231..364
AAA [PF00004], Evalue: 3.50E-20, Aligned region: 606..734
AAA_16 [PF13191], Evalue: 2.60E-12, Aligned region: 30..99
AAA_16 [PF13191], Evalue: 2.60E-12, Aligned region: 130..175
AAA_16 [PF13191], Evalue: 2.60E-12, Aligned region: 208..253
AAA_16 [PF13191], Evalue: 2.60E-12, Aligned region: 274..310
AAA_16 [PF13191], Evalue: 2.60E-12, Aligned region: 419..485
AAA_16 [PF13191], Evalue: 2.60E-12, Aligned region: 579..650
AAA_16 [PF13191], Evalue: 2.60E-12, Aligned region: 671..698
AAA_16 [PF13191], Evalue: 2.60E-12, Aligned region: 752..827
AAA_5 [PF07728], Evalue: 2.10E-10, Aligned region: 231..251
AAA_5 [PF07728], Evalue: 2.10E-10, Aligned region: 450..502
AAA_5 [PF07728], Evalue: 2.10E-10, Aligned region: 605..711
Clp_N [PF02861], Evalue: 2.70E-09, Aligned region: 27..78
Clp_N [PF02861], Evalue: 2.70E-09, Aligned region: 116..127
AAA_22 [PF13401], Evalue: 5.90E-08, Aligned region: 230..344
AAA_22 [PF13401], Evalue: 5.90E-08, Aligned region: 367..395
AAA_22 [PF13401], Evalue: 5.90E-08, Aligned region: 603..632
Sigma54_activat [PF00158], Evalue: 9.10E-08, Aligned region: 210..250
Sigma54_activat [PF00158], Evalue: 9.10E-08, Aligned region: 592..711
Zeta_toxin [PF06414], Evalue: 6.40E-07, Aligned region: 173..206
Zeta_toxin [PF06414], Evalue: 6.40E-07, Aligned region: 231..254
Zeta_toxin [PF06414], Evalue: 6.40E-07, Aligned region: 595..645
NACHT [PF05729], Evalue: 3.40E-06, Aligned region: 231..258
NACHT [PF05729], Evalue: 3.40E-06, Aligned region: 606..733
AAA_17 [PF13207], Evalue: 1.30E-05, Aligned region: 231..270
AAA_17 [PF13207], Evalue: 1.30E-05, Aligned region: 605..641
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 228..252
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 603..627
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 818..831
ClpB_D2-small [PF10431], Evalue: 4.70E-05, Aligned region: 460..481
ClpB_D2-small [PF10431], Evalue: 4.70E-05, Aligned region: 772..846
ResIII [PF04851], Evalue: 7.30E-05, Aligned region: 189..253
ResIII [PF04851], Evalue: 7.30E-05, Aligned region: 298..313
ResIII [PF04851], Evalue: 7.30E-05, Aligned region: 577..626
T2SE [PF00437], Evalue: 8.60E-05, Aligned region: 217..253
T2SE [PF00437], Evalue: 8.60E-05, Aligned region: 380..409
T2SE [PF00437], Evalue: 8.60E-05, Aligned region: 602..635
Arch_ATPase [PF01637], Evalue: 0.0001, Aligned region: 210..251
Arch_ATPase [PF01637], Evalue: 0.0001, Aligned region: 283..380
Arch_ATPase [PF01637], Evalue: 0.0001, Aligned region: 603..633
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 231..255
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 606..631
Torsin [PF06309], Evalue: 0.00074, Aligned region: 475..501
Torsin [PF06309], Evalue: 0.00074, Aligned region: 563..628
DUF87 [PF01935], Evalue: 0.002, Aligned region: 233..253
DUF87 [PF01935], Evalue: 0.002, Aligned region: 442..476
DUF87 [PF01935], Evalue: 0.002, Aligned region: 607..634
AAA_25 [PF13481], Evalue: 0.0026, Aligned region: 214..255
AAA_25 [PF13481], Evalue: 0.0026, Aligned region: 361..393
AAA_25 [PF13481], Evalue: 0.0026, Aligned region: 604..618
AAA_29 [PF13555], Evalue: 0.0027, Aligned region: 223..249
AAA_29 [PF13555], Evalue: 0.0027, Aligned region: 603..637
IstB_IS21 [PF01695], Evalue: 0.0027, Aligned region: 220..254
IstB_IS21 [PF01695], Evalue: 0.0027, Aligned region: 605..622
RNA_helicase [PF00910], Evalue: 0.0034, Aligned region: 232..252
RNA_helicase [PF00910], Evalue: 0.0034, Aligned region: 606..627
DUF815 [PF05673], Evalue: 0.004, Aligned region: 225..306
DUF815 [PF05673], Evalue: 0.004, Aligned region: 605..642
DEAD [PF00270], Evalue: 0.0058, Aligned region: 217..386
DEAD [PF00270], Evalue: 0.0058, Aligned region: 603..623
DEAD [PF00270], Evalue: 0.0058, Aligned region: 673..699
FtsK_SpoIIIE [PF01580], Evalue: 0.0085, Aligned region: 229..257
FtsK_SpoIIIE [PF01580], Evalue: 0.0085, Aligned region: 604..626
DUF2075 [PF09848], Evalue: 0.0086, Aligned region: 233..333
DUF2075 [PF09848], Evalue: 0.0086, Aligned region: 604..626
DUF2075 [PF09848], Evalue: 0.0086, Aligned region: 642..682
DUF258 [PF03193], Evalue: 0.0093, Aligned region: 225..251
DUF258 [PF03193], Evalue: 0.0093, Aligned region: 604..625
Protein Sequence: 867 a.a.     [Download]
>gi|153949405|ref|YP_001402385.1| AAA ATPase [Yersinia pseudotuberculosis IP 31758]
MGAITVYQRERLFNRLGTFAYKTFVEATRLCRSYRHEYVELEHWLKILMDQQRGDIPALLTHYGLSQTVI
STQLDRIIQHMPVTKASVQDLSSRLESVVEGGLVLSQLMASPSPIRTSHILLALLQDTQHQRWLYRLCDE
FKKLPVPQVAEEYEGLLVNSIEQTSEVQRGDALVTETDSSSSKEAHAALNKWCNDLTQQARDGEIDPVIG
REAELRQVIDILLRRRQNNPILVGEAGVGKTAVVEALARKLASGDVPPLLQGARLLSLDLGRMQAGASMR
GEFESRLKSLIDGISQSDTPVILFCDEAHTLVGAGGQAGTGDAVNLLKPMLARGALRMIAATTWSEYKQF
IEPDAALTRRFQRVLIGEPNESTAVDMLRAIAPHFAQHHNVTIRDGAIHAAVRLSLRNLPSRQLPDKAIS
LLDTACARVALSQYAQPQAIEQLSAQLDVLKTEHQYLVREKQLGEAVDQRLDDVQTQIQAFEHELTALQS
RHLHEQQLVREVLPEGEGSGMMTENARWGELMALQEASPLVYPWVDEQSIAAVLSDWTGIPSGKMLQDDI
ECVLNLEQRLGDHIFGQRNAIKEISQAIRIARAGIQSQERPLGIFLLAGSTGTGKTETANVLVETLYGGA
HNLITFNMSEFQEAHTLSTLKGAPPGYVGYGKGGKLTEAVRRKPYSVILLDEFDKAHADIQDAFYQVFDK
GWMEDAEGRRVSFRQCFILLTCNQGAEEIEQAYLTANDIKPGALKPLVYDALLRRFAPALLARVNIIPYI
PLDQDALAQIASHHLARLQTRLWDEIGATLVTEGDIPGWIASRVCSHPNHGRAVEELLRQTLLPAVGNEV
LKRRHEAEPLREIRLIVEETELSIEFA
 
Nucleotide Sequence: 2604 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c3867099-3864496 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGGGAGCGATAACGGTGTATCAACGCGAACGTCTTTTTAATCGATTGGGCACTTTTGCCTATAAAACTT
TTGTTGAAGCCACCCGTCTTTGCCGCAGTTATCGGCATGAGTATGTGGAGCTTGAACATTGGTTAAAAAT
TCTCATGGATCAACAGCGTGGGGATATTCCTGCTCTACTGACGCATTACGGACTGAGCCAAACGGTTATC
TCCACGCAATTGGATCGCATTATTCAGCATATGCCCGTCACCAAAGCATCGGTGCAGGATTTATCATCAC
GCTTGGAGTCCGTGGTCGAAGGCGGATTGGTGTTGAGCCAATTGATGGCGTCACCTTCTCCTATCCGTAC
CTCGCATATTTTACTGGCACTATTACAGGATACCCAGCATCAGCGCTGGTTATACCGCCTGTGCGATGAA
TTCAAAAAGCTGCCGGTCCCACAGGTTGCAGAGGAATATGAAGGCCTATTAGTTAACTCCATTGAACAGA
CCAGCGAGGTTCAAAGAGGCGACGCATTAGTGACGGAAACGGACAGCAGCTCATCAAAAGAAGCGCATGC
GGCATTGAACAAATGGTGTAACGACCTTACCCAGCAAGCCCGTGACGGTGAGATTGACCCCGTTATTGGT
CGTGAAGCAGAACTGCGTCAAGTGATTGATATTTTACTCCGTCGCCGTCAGAACAACCCTATTTTGGTTG
GGGAAGCGGGGGTCGGTAAAACGGCGGTGGTTGAAGCGCTAGCGCGAAAACTGGCCAGTGGCGATGTCCC
TCCGCTGTTGCAAGGGGCGCGTCTGCTTTCTCTGGATTTGGGGAGGATGCAAGCCGGTGCCAGTATGCGC
GGTGAATTTGAATCACGTCTTAAATCCCTGATCGATGGCATCAGCCAATCGGATACCCCGGTTATTCTGT
TTTGTGATGAAGCCCATACGTTGGTGGGGGCAGGCGGGCAGGCGGGCACGGGGGATGCGGTCAACCTGCT
TAAACCGATGTTGGCGAGGGGCGCATTGCGCATGATCGCCGCCACCACCTGGTCAGAGTATAAACAGTTT
ATTGAACCTGACGCCGCGCTGACCCGGCGTTTCCAGCGGGTATTGATTGGCGAGCCAAACGAATCTACCG
CCGTCGATATGCTACGGGCGATTGCGCCACATTTTGCTCAACATCATAACGTCACTATCCGCGACGGTGC
CATTCACGCGGCGGTGCGCCTGTCATTACGCAACCTGCCTTCCCGGCAGTTGCCCGATAAAGCCATCAGT
CTGCTCGACACCGCTTGCGCGCGGGTCGCGCTCAGCCAATATGCCCAACCACAGGCGATTGAACAGTTAT
CGGCCCAACTGGATGTGCTCAAAACCGAGCATCAATATCTGGTACGGGAGAAGCAACTGGGCGAAGCGGT
TGATCAACGGCTAGATGACGTTCAGACACAGATCCAGGCGTTTGAACATGAACTAACCGCCTTGCAAAGC
CGCCATCTGCATGAGCAACAGCTAGTGAGGGAGGTCCTGCCGGAGGGAGAAGGCAGTGGCATGATGACGG
AAAATGCCCGCTGGGGTGAACTGATGGCGTTACAGGAAGCGTCGCCACTGGTCTATCCATGGGTTGATGA
GCAGAGCATCGCCGCGGTGCTTTCCGATTGGACCGGGATCCCGTCCGGCAAAATGTTGCAGGACGATATT
GAATGCGTCCTGAATCTTGAACAGCGTCTCGGTGATCATATTTTCGGGCAACGCAACGCTATCAAAGAGA
TTTCGCAGGCGATACGTATTGCTCGGGCGGGCATCCAGTCTCAGGAGCGGCCACTCGGGATCTTCCTGCT
GGCGGGGTCAACCGGTACGGGCAAAACAGAAACGGCCAATGTACTGGTCGAAACCTTGTATGGCGGTGCT
CATAACCTTATTACCTTCAATATGAGTGAGTTCCAAGAGGCGCATACCTTATCCACACTGAAAGGCGCAC
CTCCGGGCTATGTCGGCTATGGCAAGGGGGGGAAATTAACCGAAGCGGTAAGACGCAAACCTTATTCGGT
CATCCTGCTTGATGAGTTTGATAAAGCTCACGCCGATATTCAGGACGCCTTTTATCAGGTCTTCGACAAA
GGGTGGATGGAAGATGCCGAAGGGCGTCGGGTCAGTTTCCGCCAGTGTTTCATCTTACTGACCTGTAATC
AGGGCGCGGAAGAGATCGAACAGGCTTACCTCACCGCCAACGATATCAAACCCGGTGCATTAAAACCGTT
GGTATACGACGCCCTGTTGCGCCGCTTTGCGCCAGCGCTGTTAGCCAGGGTCAATATCATTCCTTATATC
CCATTAGATCAGGACGCTCTGGCACAGATCGCCTCTCATCATCTTGCGCGCTTACAAACGCGCCTGTGGG
ATGAAATTGGTGCCACTTTGGTGACCGAGGGGGATATCCCCGGCTGGATCGCCTCACGGGTTTGCAGCCA
TCCGAACCATGGTCGTGCGGTGGAAGAACTCTTGCGTCAAACCTTACTTCCCGCTGTTGGCAATGAAGTG
TTGAAGCGTCGCCATGAGGCTGAACCGCTGAGAGAGATACGCCTGATTGTTGAGGAGACAGAACTGAGTA
TTGAGTTCGCGTAG
 Primer design