SecReT6
Protein ID: 153949709
SecReT6 ID222
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0795
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]954541..957963 [+]
Producthypothetical protein
NoteTssM
UniProt IDA7FEV1
KEGG IDypi:YpsIP31758_0795
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.10E-75, Aligned region: 83..122
IcmF-related [PF06761], Evalue: 1.10E-75, Aligned region: 418..736
DUF1215 [PF06744], Evalue: 2.40E-37, Aligned region: 859..980
Protein Sequence: 1140 a.a.     [Download]
>gi|153949709|ref|YP_001399779.1| hypothetical protein YpsIP31758_0795 [Yersinia pseudotuberculosis IP 31758]
MKRIALPIKKPEVWFWIVALLFLLAGAVLCWLVWQHPERVGLIQGTPQRDRWLTGLVVGTGILTLCALLS
YVGTRLSGRKHFDEIRQQAQGDDVSLLKENAKVGDIQQSELSHLKTRLRRRYGLFWRYKVRLLMVVGEPD
EIAALAPQLAEQGWLEGQRTVLIHGDSVQSPADETGLSEWRKLRRGRPFDGIVWAITAAQSSHPQWMDNG
LRTLEKMGATLRYQPPVYLWQVCGSGWPQDTRVEQPVGVVFPAKATPEQVELQLRALLPQLREQGMQQLS
VEPHHDFLLRLAQSLEQGDATRWRQRLTPWFTEYAARIPLRGLMFSLPEVSTSAARVHEKNWTASDRWQG
ILDDCRSARGRRVGLPWEQTLCYSLLALIVLWGVGSVVSFAVNRHQMVSAAQQAQQLAQSQAVSDQQLMA
LQALRNDIGRLQSRVAQGAPWYQRFGLDHNAPLLEVLMPWYGQANNRILRDATAQSLHQKLSELAELPAN
SPQRAVLAKTGYDQLKAYLMMSRPEKADAAFYAQVMQTTEPVRAGVSPGLWQSLAPDLWQFYAQNLPAQP
DWKIKPDTGLVSQVRQVLLGQIGQRNAESTLYENMLLSVRRNYADMTLTDMTGDTDAQRLFQTSESVPGM
FTRKAWDEQIQQAIDKTVASRREEIDWVLSDNRRAISEDISPEALKKRLTERYFTDFAGSWLSFLNSLHW
NEAHNLSDVIDQLTLMSDVRQSPLIALMNTLAWQGQTGQQNQALSDSLVKSAKALMNKDQAPAIDQSAGG
PVGPLDETFGPLLALMGKGDAQNRLSSDSSLSLQTLLTRVTRVRLKLQQVVNASNPQEMTQVLAQTVFQG
KSVDLTDTQEYGSLIAASLGEEWSSFGQTMFVQPLTQAWETVLQPSSASLNDQWKNAVVANWKSAFDGRY
PFAASKSDASLPMLAEFIRKDSGRIDSFLTRELGGVLHKEGTRWVPSKVNSQGLTFNSDFLAAINQLSQV
SDILFTDGSQGLRFELLARPVPNVVETHLAIDGQKLHYFNQMESWQSFRWPGDTYKPGTLLTWTGVNSGA
RLYGDYQGTWGLIRWLEQAKQKKLDEGRYQLTFTTADNLPLQWILRTELGKGPLGLLQLRNFTLPAQIFL
IQSAPSAASDRTDDEDMAED
 
Nucleotide Sequence: 3423 bp     [Download]
>gi|153946813|ref|NC_009708.1|:954541-957963 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
GTGAAGCGCATTGCCTTACCGATTAAAAAGCCAGAAGTCTGGTTCTGGATTGTTGCTCTGTTATTTTTGC
TGGCGGGTGCCGTGTTGTGCTGGCTGGTCTGGCAACATCCAGAACGGGTAGGATTAATTCAGGGAACACC
GCAACGTGATCGCTGGCTGACGGGACTGGTGGTGGGAACAGGGATACTGACCTTGTGCGCATTACTGTCG
TATGTGGGGACCCGATTATCCGGCAGAAAACACTTTGATGAGATACGGCAGCAGGCACAAGGTGATGATG
TGTCGTTGCTGAAAGAAAACGCGAAGGTGGGAGATATTCAGCAGAGCGAACTGTCCCATTTGAAAACCCG
TCTGCGCCGCCGTTACGGGCTGTTCTGGCGCTACAAAGTCCGGTTGCTGATGGTGGTGGGAGAGCCTGAC
GAAATCGCTGCATTGGCTCCGCAACTGGCGGAACAGGGCTGGCTGGAAGGGCAGCGTACGGTGCTGATTC
ACGGTGATAGTGTCCAAAGTCCAGCCGATGAAACCGGGCTGAGTGAGTGGCGTAAACTGCGCCGTGGCCG
CCCGTTTGATGGCATTGTTTGGGCGATAACCGCCGCGCAAAGTAGTCATCCACAGTGGATGGACAACGGC
CTGCGGACGCTGGAGAAAATGGGCGCAACCTTGCGCTATCAACCGCCGGTGTATCTGTGGCAGGTCTGCG
GCAGCGGCTGGCCTCAGGATACGCGGGTGGAGCAGCCGGTCGGGGTGGTGTTCCCGGCGAAGGCCACGCC
AGAGCAGGTTGAGCTTCAACTGCGCGCTCTGTTGCCTCAGTTACGTGAGCAGGGGATGCAGCAGCTTTCT
GTCGAACCGCACCATGATTTCTTGTTGCGTCTGGCGCAGTCGCTGGAGCAGGGCGATGCCACCCGCTGGC
GGCAGCGTCTGACGCCGTGGTTTACCGAGTATGCGGCGCGTATTCCCCTGCGTGGGTTGATGTTCAGTTT
GCCGGAGGTATCAACATCGGCGGCGCGTGTGCACGAGAAAAACTGGACTGCATCTGACCGCTGGCAGGGG
ATACTGGATGACTGTCGTTCTGCCCGTGGACGCCGTGTCGGGCTGCCGTGGGAGCAGACATTGTGCTACA
GCTTGCTGGCACTGATAGTGCTGTGGGGCGTGGGCAGTGTCGTGTCATTTGCGGTCAACCGTCACCAAAT
GGTCTCTGCCGCGCAGCAGGCACAGCAACTGGCGCAGTCGCAAGCGGTCTCTGACCAGCAACTCATGGCC
CTACAAGCCCTGCGCAATGATATCGGGCGCTTACAATCTCGCGTGGCGCAGGGGGCACCTTGGTATCAGC
GCTTTGGCCTGGATCATAATGCGCCGCTGCTTGAGGTCCTGATGCCGTGGTATGGCCAGGCCAACAACCG
CATTCTTAGGGATGCTACCGCGCAAAGCCTGCATCAGAAACTCAGTGAACTGGCGGAGCTGCCCGCCAAC
AGCCCGCAACGTGCGGTACTGGCAAAAACAGGCTATGACCAGTTAAAGGCCTATCTGATGATGTCACGTC
CGGAAAAAGCCGATGCTGCATTTTATGCACAGGTGATGCAGACCACCGAGCCTGTGCGTGCCGGTGTATC
TCCTGGTCTGTGGCAGAGTCTGGCCCCAGACTTATGGCAATTTTATGCGCAAAACCTGCCTGCTCAGCCG
GACTGGAAAATTAAACCGGATACCGGGTTGGTAAGCCAGGTACGGCAGGTCTTACTGGGGCAGATTGGTC
AGCGCAATGCAGAAAGTACGCTGTATGAAAACATGCTGCTATCAGTGCGTCGCAACTATGCCGACATGAC
GCTGACGGACATGACCGGCGACACTGATGCTCAGCGTCTGTTCCAGACCTCGGAATCCGTGCCCGGTATG
TTTACCCGCAAGGCCTGGGATGAGCAAATCCAGCAGGCAATAGATAAAACGGTGGCCTCCCGCCGCGAAG
AGATTGACTGGGTATTGAGTGATAACCGCCGGGCGATATCCGAAGATATCTCACCGGAAGCGCTGAAAAA
ACGCCTGACCGAACGTTATTTCACCGATTTTGCTGGCAGTTGGCTGAGTTTCCTCAACAGTTTGCACTGG
AATGAGGCGCATAACCTGTCGGATGTGATTGACCAACTGACCTTGATGAGTGATGTACGCCAGTCGCCGC
TGATTGCGCTAATGAACACGCTGGCGTGGCAAGGGCAGACCGGGCAGCAGAATCAGGCATTATCGGATTC
GCTGGTGAAGTCTGCCAAGGCGCTGATGAATAAAGACCAGGCTCCGGCGATTGACCAGAGTGCCGGTGGG
CCAGTAGGGCCACTGGACGAGACCTTTGGCCCGTTGCTGGCACTGATGGGCAAAGGCGATGCACAAAACA
GGCTGTCGTCGGACAGCTCGCTGAGCCTGCAAACGTTGCTCACCCGCGTGACCCGGGTGCGGCTTAAACT
CCAGCAAGTGGTTAATGCCTCGAACCCACAAGAGATGACTCAGGTGCTGGCCCAGACCGTTTTCCAGGGG
AAAAGTGTCGACCTGACGGACACGCAGGAGTACGGCAGCCTGATTGCCGCCAGTCTGGGGGAAGAGTGGA
GCAGTTTCGGGCAGACGATGTTTGTTCAGCCGCTGACGCAGGCGTGGGAGACCGTGTTGCAACCTTCGTC
GGCCAGCCTTAACGACCAGTGGAAAAACGCGGTGGTGGCCAATTGGAAATCAGCCTTTGACGGGCGTTAC
CCGTTTGCCGCCAGTAAAAGCGATGCTTCACTGCCGATGCTGGCCGAATTTATTCGTAAGGATAGCGGGC
GTATCGACAGCTTCCTGACCCGTGAGCTGGGTGGCGTGCTGCATAAAGAAGGGACGCGCTGGGTTCCGAG
TAAAGTGAACAGCCAGGGGCTAACGTTTAACTCGGACTTTCTGGCGGCCATTAATCAACTGAGTCAAGTC
TCCGATATTCTGTTCACTGACGGCAGTCAGGGGCTGCGCTTTGAGCTACTGGCACGCCCGGTTCCGAATG
TGGTGGAAACCCATTTAGCGATTGATGGACAGAAATTGCATTATTTCAACCAGATGGAAAGTTGGCAGAG
TTTCCGCTGGCCGGGTGATACCTACAAACCCGGCACGCTATTGACCTGGACTGGCGTGAATTCCGGGGCC
CGTTTATACGGTGATTATCAGGGGACATGGGGATTGATCCGCTGGCTGGAACAGGCAAAACAGAAAAAGC
TGGATGAAGGGCGTTATCAACTGACCTTCACCACCGCGGATAACCTACCACTGCAATGGATATTACGCAC
TGAGCTGGGCAAAGGTCCATTAGGTCTGCTGCAACTGCGTAACTTTACCCTGCCTGCGCAAATTTTTCTG
ATACAGAGCGCCCCTTCAGCGGCATCTGATCGGACCGATGATGAGGATATGGCAGAGGATTAA
 Primer design