SecReT6
Protein ID: 15595275
SecReT6 ID3
T6SS typei3
Gene symbolicmF1
Locus tagPA0077
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]91521..94826 [-]
ProductIcmF1
NoteTssM
UniProt IDQ9I755
KEGG IDpae:PA0077
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.50E-98, Aligned region: 15..52
ImcF-related_N [PF14331], Evalue: 1.50E-98, Aligned region: 117..380
IcmF-related [PF06761], Evalue: 8.20E-92, Aligned region: 159..179
IcmF-related [PF06761], Evalue: 8.20E-92, Aligned region: 429..724
DUF1215 [PF06744], Evalue: 5.40E-41, Aligned region: 619..651
DUF1215 [PF06744], Evalue: 5.40E-41, Aligned region: 839..960
AAA_10 [PF12846], Evalue: 0.0011, Aligned region: 55..212
AAA_10 [PF12846], Evalue: 0.0011, Aligned region: 523..608
AAA_16 [PF13191], Evalue: 0.003, Aligned region: 52..180
AAA_16 [PF13191], Evalue: 0.003, Aligned region: 519..570
AAA_16 [PF13191], Evalue: 0.003, Aligned region: 702..774
Protein Sequence: 1101 a.a.     [Download]
>gi|15595275|ref|NP_248767.1| icmF1 gene product [Pseudomonas aeruginosa PAO1]
MQSLAEVSAPDAASVATAEELATLKQRMDEALALLKRAKLGGSERRNLYELPWYVIIGPPGSGKTTALMN
SGLDFPLAAQMGAGAIRGVGGTRNCDWWFTDEAVLLDTAGRYTTQDSHAQVDKAAWLGFLDLLKTQRKRR
PIDGAFIAISLSDLLLGSDAERAAHAQAIRARIQELYQQLGVRFPIYVMLTKFDLVPGFMEFFDSLNREE
RAQVWGMTFALDDGKSAEGPLAVFDSEFALLEQRLTARLVERLQQERDPARRDLVYGFPQQFAALRECLG
EFLNGVFKPNPYEERPLLRGLYFTSGTQEGSPIDRLIGSMAQSMNLDRQHLARQTGTGRSYFIERLFREV
AFGERGLVGTNPKVERRRKWLTIGALSATALVVLAVTAVWIASYRANQSYIAAVDQRVDPLARGIESLSP
AQRDVLAVLPQLNAVQNLAGDAPSWAEGYGLYQGDMLGEESASVYRKLLIAVFAPRLVTRIEEQLRSGGS
SDFLYEGLKAYLMLGSPDHYDADFIKAWISLDWERNLPRDLSPEQRQALHAHLDALLERRPPSARLDQDL
VEDLRRQLQQLPVAQRVYDRVKRQRLPKDVPDFRISDAAGRDAPLVFARKSGKPLTDPLSGFFTYRGYRE
VFLTASLSQAGTIAEEQWVLGRDLNDAGDAANLALDVRRLYFQDYLRQWDDLLADLTVVPITNVTQAADV
LRILSGPTSPFRKLLEAVARETDLQKGDRLVAAQVKKAADGTVDKLKQRLGSLVGQEEEGAREQPRQVDS
DPISAHFAELNSLVSKGEGGNEPAPIDSLLEDMNALYVQVSAMAGASGDSLLGDAKNQVAAAASRVALSA
ERQPPVVQGLVKNVVNSTTSSMMGSVRNQLNAAWISDVVSVYRQSLAGRYPIAAGSSRDATLEDFGHFFG
AGGVMDSYFRQYLQPYVDTSASTWRWQPGAAQKLGINPGVLHTFQRAAAIRDAFFRSGGMQPTVRFELKP
VTMDAAISQFILDLDGQQLTYDHGPSRPVAMQWPSANGLGVVRLTVTPPPSSGRSGLTLEGPWAWFRLLD
QSDLERGNSPDRFTLRLRIDGSSIACELRASSAFNPFKSRVVSGFSLPERL
 
Nucleotide Sequence: 3306 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c94826-91521 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGCAGAGTCTCGCCGAGGTCAGCGCGCCGGACGCCGCCAGCGTCGCCACCGCCGAAGAGCTGGCGACCC
TCAAGCAACGCATGGACGAGGCCCTGGCCCTGCTCAAGCGGGCCAAGTTGGGCGGCAGCGAGCGGCGCAA
CCTGTACGAGTTGCCCTGGTACGTGATCATCGGCCCGCCCGGTTCGGGCAAGACCACCGCGCTGATGAAT
TCCGGCCTCGACTTCCCGCTCGCCGCGCAGATGGGCGCCGGGGCGATCCGCGGGGTCGGCGGCACGCGCA
ACTGCGACTGGTGGTTCACCGACGAAGCGGTGCTGCTGGACACCGCCGGCCGCTATACCACCCAGGACAG
CCACGCCCAGGTGGACAAGGCCGCCTGGCTGGGCTTCCTCGACCTGCTCAAGACCCAGCGCAAGCGCCGC
CCCATCGATGGCGCGTTCATCGCCATCAGCCTTTCCGACCTGCTGCTGGGCAGCGACGCCGAGCGCGCCG
CCCATGCCCAGGCGATCCGCGCACGCATCCAGGAGCTGTACCAGCAGCTCGGGGTGCGCTTCCCGATCTA
CGTGATGCTGACCAAGTTCGACCTGGTGCCGGGCTTCATGGAGTTCTTCGACAGCCTGAACCGCGAGGAA
CGCGCGCAGGTCTGGGGGATGACCTTCGCCCTCGACGACGGCAAGAGCGCGGAAGGCCCGCTGGCGGTGT
TCGACAGCGAATTCGCCCTGCTCGAACAGCGTCTCACCGCGCGCCTGGTGGAACGCCTGCAGCAGGAGCG
CGACCCGGCGCGGCGCGACCTGGTCTACGGCTTCCCGCAGCAATTCGCCGCCCTGCGCGAATGCCTCGGC
GAGTTCCTCAACGGCGTGTTCAAGCCCAACCCCTACGAGGAACGCCCGCTGTTGCGCGGCCTGTACTTCA
CCAGCGGAACCCAGGAAGGCAGTCCGATCGACCGCCTGATCGGCAGCATGGCGCAGTCGATGAACCTCGA
CCGCCAGCACCTGGCGCGGCAGACCGGAACCGGGCGCAGCTACTTCATCGAGCGGCTGTTCCGCGAAGTG
GCGTTCGGCGAACGCGGCCTGGTCGGCACCAACCCGAAGGTCGAGCGCCGCCGCAAGTGGCTGACCATCG
GCGCGCTGAGCGCCACCGCGCTGGTGGTGCTGGCGGTGACGGCGGTATGGATCGCCAGCTACCGCGCCAA
CCAGAGCTACATCGCCGCGGTCGACCAGCGCGTCGACCCGCTGGCGCGCGGCATCGAGTCGCTGAGCCCG
GCCCAGCGCGACGTCCTGGCCGTACTGCCACAGCTCAACGCGGTGCAGAATCTCGCCGGCGACGCGCCGA
GCTGGGCCGAAGGCTACGGGCTGTACCAGGGCGACATGCTCGGCGAGGAGTCCGCCAGCGTCTACCGCAA
GCTGCTGATCGCGGTGTTCGCCCCGCGCCTGGTGACCCGCATCGAGGAACAGTTGCGCTCCGGCGGCAGC
AGCGATTTCCTCTACGAGGGCCTGAAGGCCTACCTGATGCTCGGCAGCCCGGACCATTACGACGCCGACT
TCATCAAGGCCTGGATCAGCCTCGACTGGGAACGCAACCTGCCGCGCGACCTCTCGCCGGAACAGCGCCA
GGCGCTGCACGCGCACCTCGACGCGTTGCTCGAACGACGGCCGCCGTCGGCGCGCCTGGACCAGGACCTG
GTCGAGGACCTGCGCCGCCAGTTGCAGCAACTGCCGGTGGCGCAGCGGGTCTACGACCGGGTCAAGCGGC
AGAGGCTGCCCAAGGACGTGCCCGACTTCCGCATCAGCGACGCCGCCGGCCGCGACGCGCCGCTGGTGTT
CGCGCGCAAGAGCGGCAAGCCGCTCACCGACCCGCTCAGCGGCTTCTTCACCTACCGCGGCTATCGCGAG
GTGTTCCTCACCGCCAGCCTCAGCCAGGCCGGCACCATCGCCGAGGAACAGTGGGTGCTCGGGCGCGACC
TGAACGATGCCGGCGACGCCGCCAACCTGGCCCTCGACGTGCGTCGCCTGTATTTCCAGGACTACCTGCG
GCAGTGGGACGACCTGCTCGCCGACCTCACCGTGGTGCCGATCACCAATGTCACCCAGGCCGCCGACGTG
CTGCGCATTCTCTCCGGGCCGACCTCGCCGTTCCGCAAGCTGCTCGAGGCAGTGGCCCGCGAGACCGACC
TGCAGAAGGGCGACCGGCTGGTCGCCGCGCAAGTGAAGAAGGCCGCCGACGGCACCGTGGACAAGCTCAA
GCAGCGCCTCGGCTCGCTGGTCGGCCAGGAGGAAGAGGGCGCCCGCGAACAGCCGCGGCAGGTCGACAGC
GACCCGATCAGCGCCCACTTCGCCGAACTCAACAGCCTGGTCAGCAAGGGCGAGGGCGGCAACGAGCCGG
CGCCGATCGACAGCCTGCTGGAAGACATGAACGCGCTCTACGTGCAGGTCAGCGCCATGGCCGGAGCCAG
CGGCGACTCGCTGCTCGGCGACGCCAAGAACCAGGTGGCCGCCGCCGCCTCGCGCGTGGCCCTCAGCGCC
GAGCGCCAGCCGCCGGTGGTCCAGGGCCTGGTGAAGAACGTGGTCAACTCCACCACCAGCAGCATGATGG
GCAGCGTGCGCAACCAGCTCAACGCGGCCTGGATCAGCGACGTGGTCAGCGTCTACCGGCAATCCCTGGC
CGGGCGCTACCCGATCGCCGCCGGCAGTTCGCGCGACGCCACCCTGGAAGACTTCGGCCACTTCTTCGGT
GCCGGCGGGGTGATGGACAGCTACTTCCGCCAGTACCTGCAACCCTACGTCGACACCTCCGCCAGCACCT
GGCGCTGGCAGCCCGGCGCGGCGCAGAAGCTCGGCATCAACCCCGGCGTGCTGCACACTTTCCAGCGCGC
GGCGGCGATCCGCGACGCCTTCTTCCGCTCCGGCGGCATGCAACCGACGGTGCGCTTCGAGCTCAAGCCG
GTGACCATGGACGCGGCGATCAGCCAGTTCATCCTCGACCTCGACGGCCAGCAGCTGACCTACGACCACG
GCCCCAGCCGCCCGGTGGCGATGCAGTGGCCGAGCGCCAACGGCCTCGGCGTGGTCCGCCTGACGGTGAC
GCCGCCGCCCAGCAGCGGCCGTTCCGGCCTGACCCTGGAAGGCCCCTGGGCCTGGTTCCGCCTGCTCGAC
CAGTCGGACCTGGAACGCGGCAACTCGCCGGACCGCTTCACCCTGCGGCTGCGCATCGACGGCTCCAGCA
TCGCCTGCGAGCTGCGCGCCAGCAGCGCCTTCAACCCCTTCAAGAGCCGGGTCGTGTCCGGCTTCAGCCT
CCCGGAGCGCCTTTGA
 Primer design