SecReT6
Protein ID: 15596860
SecReT6 ID4
T6SS typei1
Gene symbol-
Locus tagPA1663
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H2-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]1813395..1814906 [+]
Producttranscriptional regulator
NoteSfa2
UniProt IDQ9I362
KEGG IDpae:PA1663
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 1.90E-70, Aligned region: 195..362
Sigma54_activ_2 [PF14532], Evalue: 2.00E-22, Aligned region: 196..366
HTH_8 [PF02954], Evalue: 4.20E-13, Aligned region: 352..359
HTH_8 [PF02954], Evalue: 4.20E-13, Aligned region: 454..493
AAA_5 [PF07728], Evalue: 1.70E-07, Aligned region: 219..337
GAF_3 [PF13492], Evalue: 0.00015, Aligned region: 29..149
GAF_3 [PF13492], Evalue: 0.00015, Aligned region: 202..261
HTH_30 [PF13556], Evalue: 0.00027, Aligned region: 463..495
GAF_2 [PF13185], Evalue: 0.00053, Aligned region: 37..174
GAF_2 [PF13185], Evalue: 0.00053, Aligned region: 286..290
Protein Sequence: 503 a.a.     [Download]
>gi|15596860|ref|NP_250354.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MFSRVPQPLAFAEALLAQFGALSRETDITALLGGFARAVGELSGCELSQLYLLDQTHTALTLNAECRDGL
LQALEPSSLPADYTGEQLLQFALCQNRVVSLVDLPSRLHETGFLPAGEQPWLSLLCVPLVSPEKTVEGMV
VCATRRPLDLQGFAHPLGQLGSFVLAQLHLLQRLSQPSGEPQGPSSAPVVSGYGLIGRSAAMRETCRLIS
KVLHNPYTVLLQGETGTGKEVVARAIHEYGPRRAQAFVVQNCAAFPENLLESELFGYRKGAFTGAERDRP
GLFDAADGGTLLLDEIGDMPLSLQAKLLRVLQEGEIRPLGGNDTHKVDVRIIAATHRDLALLVRDGKFRE
DLYYRLAQFPIELPPLRQREGDALELARHFAERACVFLRRAPLGWSAEALELLDGYGFPGNVRELKGLVE
CAVLLCEGEMLLAEHFSLRAPPEAEAPLKLREHLEQIERDLLLACLRRNAGNQTLAARELGLPRRTLIYR
MGRLNIHFGDPRT
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|110645304|ref|NC_002516.2|:1813395-1814906 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGTTCAGCCGCGTACCGCAACCCCTGGCCTTCGCCGAAGCCCTGCTCGCTCAGTTCGGCGCGCTGTCGC
GGGAAACCGACATCACGGCCCTGCTGGGCGGTTTCGCACGCGCAGTCGGCGAACTCAGCGGCTGCGAGCT
GAGCCAGTTGTATCTGCTCGACCAGACCCATACCGCGCTCACCCTCAACGCCGAATGCCGGGACGGCCTG
TTGCAGGCGCTGGAGCCGTCGAGCCTGCCGGCGGACTACACCGGCGAGCAGTTGCTGCAGTTCGCCCTGT
GCCAGAACCGCGTGGTCAGTCTCGTCGACCTGCCGTCGCGGCTGCACGAGACCGGCTTCCTGCCGGCAGG
GGAGCAGCCCTGGCTGTCCCTGCTCTGCGTTCCGCTGGTGAGCCCGGAGAAAACGGTCGAGGGCATGGTG
GTCTGCGCTACCCGGCGGCCATTGGACCTGCAGGGATTCGCCCATCCACTGGGCCAGCTGGGCTCGTTCG
TGCTGGCCCAGCTGCATCTGCTGCAACGCCTCTCGCAACCCTCCGGCGAGCCGCAGGGACCGTCCAGCGC
ACCGGTGGTCAGCGGCTACGGGCTGATCGGCAGGAGCGCGGCGATGCGTGAGACCTGCCGCCTGATCAGC
AAGGTCCTGCACAACCCCTATACCGTGTTGCTGCAGGGCGAGACCGGCACCGGCAAGGAGGTGGTCGCAC
GGGCGATCCACGAGTACGGCCCGCGGCGTGCACAGGCGTTCGTGGTGCAGAACTGCGCGGCGTTTCCGGA
AAACCTGCTGGAAAGCGAGCTGTTCGGCTACCGCAAGGGCGCCTTTACCGGTGCCGAGCGCGATCGTCCC
GGGTTGTTCGATGCCGCGGATGGCGGAACCCTGCTGCTCGACGAAATCGGCGACATGCCCCTCTCGCTCC
AGGCCAAGCTGTTGCGCGTGTTGCAGGAAGGCGAGATTCGCCCGCTCGGCGGCAACGATACGCACAAGGT
CGATGTACGCATCATCGCCGCTACCCACCGTGACCTCGCCCTGCTGGTACGCGATGGCAAGTTCCGCGAA
GACCTCTACTACCGGCTGGCGCAGTTTCCCATCGAGTTGCCGCCGTTGCGCCAGCGCGAGGGCGACGCCC
TCGAACTGGCCCGGCATTTCGCCGAGCGCGCCTGCGTGTTCCTGCGCCGCGCGCCGCTGGGCTGGTCCGC
GGAAGCGCTGGAACTGCTCGACGGCTATGGCTTTCCCGGCAACGTTCGGGAGCTGAAGGGATTGGTGGAA
TGCGCGGTACTGCTCTGCGAAGGCGAGATGCTGCTGGCCGAACACTTTTCCCTGCGCGCGCCCCCGGAAG
CGGAGGCGCCGCTCAAGCTGCGCGAGCATCTGGAGCAGATCGAACGGGACCTGCTGCTCGCCTGCCTGCG
CAGGAACGCTGGCAACCAGACCCTCGCCGCGCGCGAACTGGGTCTGCCGCGACGAACCCTGATCTATCGC
ATGGGACGCCTGAACATTCATTTCGGCGATCCCCGGACCTGA
 Primer design