SecReT6
Protein ID: 15596866
SecReT6 ID4
T6SS typei1
Gene symbol-
Locus tagPA1669
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H2-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]1819074..1822601 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ9I356
KEGG IDpae:PA1669
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.80E-76, Aligned region: 255..273
IcmF-related [PF06761], Evalue: 1.80E-76, Aligned region: 502..792
IcmF-related [PF06761], Evalue: 1.80E-76, Aligned region: 948..996
ImcF-related_N [PF14331], Evalue: 6.90E-75, Aligned region: 196..453
DUF1215 [PF06744], Evalue: 6.00E-34, Aligned region: 910..1034
Protein Sequence: 1175 a.a.     [Download]
>gi|15596866|ref|NP_250360.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MKNFFKKVGAFLRKTWVWTLLLVLLAALLVWFVGPLLAVADYKFWESPTSRLLSISLMFLVWGLAMVFVS
WRAGVRRKAVEDSDEGQERLRRDGLIEDEQKELRSRFKDALRTLKTSSLYRGRSERWRNELPWYLLIGPQ
GSGKTSLLDFSGLEFPINRIDRKLTRDTAGTRYCDWYFADHGVLIDTAGRYLTQADGEVDGGAWATLLGL
LRKRRRARPLNGVMVSIPVETLLSDDEMALDTLARQVRARLQEIQQTLHLDLPVYLVLSKADQLLGFDEF
FDQLSREESDQVLGTSFGKEQNGTDVTVLRQAFEDLLRRLNSQVIMRIHQERDTLRRGRILDFPHQLGQI
GERLCLFVELAFTGNRYQRASRLRGFYLTSAPHLAQQLDEDTAGIGANLGIASGLLPTLRNGRSRFIHHL
LSQVIFPEANLAGLDRRERTRIHWGQRALYVGSLALLLLFGLLWAGGFSANHERLERLRELAQQWTQQRQ
ALGERDDAMAALKTLDSSYAATTVFPPKGEVSLHERAGLYQGNEVNPPLAAAYRRELETQLLPRVARMLE
AQIRGNMQNRERLLNSLRAYLMLNLRERRENGWLKDWVATDWSQRYAGNGTVQNGLNTHFARLLEQPFSY
PLNETLVAQARQVLRSESLANVVYRVLREQARSLPEYRFGQHLGPQAGLFVGTDYVIPGFYTQQGYQQYF
VVQGASLVNDILRDNWVLGEGSGISDMDLRRLMVELEQLYFRDYANFWSEAVGRLGLLPFNDAGEGADQV
SGLLAANSPILQLLLEVRENTRFPVLAESAEALAEASDKAAEKGGKLGKAAAAAAGKARDALAKNLPDTA
KKSLQRRFEPLHRLLDDNNGPAADLTPLLQALNELQLQLAGLARASQPEQAAFDMAKSRMGGQRDALSNL
RNASARLPRPLGGWFSVLAEDAWRLVLGDAYLYLNQRYQSELYGFYSKAINKRYPFNAHSASDVAVSDFR
EFFKAQGVAERFFETYMRPFVSGDPGSYRLRSVDGYSLPMSKVYLDQMGTAQLIRQSFFAENPAEPQVRF
RLEPYTLDPGVSRAEFRFDGQSMEYRHGPIVPMSFKWPSDADGGRTSLVLEKMAGRPVGIERNTGPWSLF
RLFDLMQTEYLSGRDVMVLKADLGGLRANYLLLAQRTPNPFDLAVLRSFRMPVQL
 
Nucleotide Sequence: 3528 bp     [Download]
>gi|110645304|ref|NC_002516.2|:1819074-1822601 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGAAAAACTTCTTCAAGAAAGTCGGCGCCTTCCTGCGCAAGACGTGGGTCTGGACGCTGTTGCTGGTAC
TCCTGGCGGCATTGCTGGTGTGGTTCGTCGGGCCGCTGCTGGCGGTCGCCGACTACAAGTTCTGGGAAAG
CCCGACCTCGCGGTTGCTGAGCATCAGCCTGATGTTCCTGGTCTGGGGGCTGGCGATGGTCTTCGTCAGC
TGGCGCGCCGGAGTGCGGCGCAAGGCCGTCGAGGACAGCGACGAGGGCCAGGAGCGCCTGCGCCGCGACG
GTCTGATCGAAGACGAACAGAAGGAATTGCGCAGCCGCTTCAAGGACGCCTTGCGCACCCTGAAGACCTC
CAGCCTGTACCGCGGCCGCAGCGAGCGCTGGCGCAACGAGCTGCCCTGGTACCTGCTGATCGGCCCGCAG
GGAAGCGGCAAGACCAGCCTGCTGGACTTTTCCGGACTGGAATTCCCGATCAACCGGATCGACCGCAAGC
TGACCCGCGACACCGCCGGCACGCGCTACTGCGACTGGTACTTCGCCGACCACGGCGTCCTGATCGACAC
CGCCGGGCGCTACCTGACCCAAGCCGACGGCGAGGTCGACGGGGGCGCCTGGGCGACCCTGCTCGGCCTG
TTGCGCAAGCGCCGCCGCGCACGGCCGCTGAATGGAGTGATGGTGTCGATTCCGGTGGAAACGTTGCTCA
GCGACGACGAGATGGCGCTGGATACGCTGGCTCGCCAGGTGCGCGCGCGCCTGCAGGAAATCCAGCAGAC
CCTGCACCTCGATCTGCCGGTCTACCTGGTGCTGAGCAAGGCCGACCAGTTGCTCGGCTTCGACGAGTTC
TTCGACCAGTTGAGCCGCGAGGAGAGCGACCAGGTTCTGGGCACCAGCTTCGGCAAGGAGCAGAACGGCA
CCGATGTGACGGTTCTGCGCCAGGCGTTCGAGGACCTTCTGCGACGTCTGAACAGCCAGGTGATCATGCG
CATCCACCAGGAGCGCGATACCCTGCGTCGCGGTCGCATCCTCGACTTCCCGCACCAGCTTGGCCAGATC
GGCGAGCGGTTGTGCCTGTTCGTCGAACTCGCCTTCACTGGCAATCGCTACCAGCGCGCCAGCCGCCTGC
GCGGCTTCTACCTGACCAGCGCGCCGCACCTGGCCCAGCAGCTGGATGAAGACACCGCCGGCATCGGCGC
CAACCTGGGGATCGCCAGCGGCCTGTTGCCGACCCTGCGCAACGGGCGCTCGCGCTTCATCCATCACCTG
CTGAGCCAGGTGATCTTCCCCGAGGCCAACCTGGCAGGTCTCGATCGCCGCGAACGCACGCGCATCCACT
GGGGCCAGCGCGCCCTGTACGTCGGTTCGCTGGCGCTCCTTCTGCTATTCGGCCTGCTCTGGGCTGGCGG
TTTCTCGGCCAACCACGAGCGCCTGGAGCGGCTACGCGAGCTGGCGCAGCAATGGACCCAGCAGCGCCAG
GCGCTTGGCGAGCGCGATGACGCCATGGCGGCGCTGAAGACGCTGGATAGCAGCTATGCGGCGACCACCG
TGTTTCCGCCCAAAGGGGAAGTCTCGCTGCACGAGCGCGCCGGGCTGTACCAGGGCAACGAGGTCAACCC
GCCGCTGGCCGCGGCCTATCGCCGCGAGCTGGAGACGCAACTGCTGCCGCGCGTGGCGCGGATGCTCGAA
GCGCAGATCCGCGGCAACATGCAGAATCGCGAACGCCTGCTCAACAGCCTGCGGGCCTACCTGATGCTGA
ATCTGCGCGAGCGCCGCGAGAACGGATGGCTCAAGGACTGGGTGGCTACCGACTGGTCGCAGCGCTATGC
CGGCAACGGCACCGTGCAGAATGGCCTGAACACGCATTTCGCCCGTCTGCTCGAGCAACCGTTCAGCTAT
CCGCTGAACGAGACCCTGGTGGCCCAGGCACGCCAGGTGCTGCGCAGCGAGTCCCTGGCCAACGTGGTCT
ACCGGGTGCTGCGCGAACAGGCGCGAAGCCTGCCCGAGTATCGCTTCGGCCAGCACCTGGGGCCGCAGGC
CGGTCTGTTCGTCGGCACCGACTACGTGATCCCGGGCTTCTACACCCAGCAGGGCTACCAGCAGTACTTC
GTGGTCCAGGGCGCCAGCCTGGTCAACGACATCCTTCGCGACAACTGGGTCCTGGGCGAGGGCAGCGGGA
TCAGCGACATGGACCTGCGGCGCCTGATGGTCGAACTCGAGCAGTTGTATTTCCGCGACTACGCGAACTT
CTGGAGCGAGGCGGTCGGACGCCTGGGCCTGCTGCCGTTCAACGATGCCGGCGAGGGCGCCGACCAGGTT
TCCGGGCTGCTCGCCGCCAACTCGCCGATCCTCCAGTTGTTGCTGGAGGTCCGTGAGAACACCCGTTTCC
CGGTCCTGGCGGAGAGCGCCGAGGCGCTGGCAGAGGCCAGCGACAAGGCCGCGGAAAAGGGCGGCAAGCT
GGGCAAGGCGGCCGCCGCGGCGGCCGGCAAGGCCAGGGACGCGTTGGCGAAGAACCTGCCGGATACCGCG
AAGAAGTCCCTGCAACGCCGCTTCGAGCCCCTGCATCGCCTGCTCGACGATAACAACGGCCCGGCGGCCG
ACCTCACCCCGCTGTTGCAGGCGCTCAACGAGTTGCAGTTGCAACTCGCCGGACTGGCGCGCGCCAGCCA
GCCGGAGCAGGCGGCTTTCGACATGGCGAAGAGCCGCATGGGCGGCCAGCGCGATGCCCTGAGCAACCTG
CGCAACGCCTCCGCGCGACTGCCGCGACCGCTCGGCGGATGGTTCAGCGTGCTGGCCGAAGACGCCTGGC
GGCTGGTCCTCGGCGATGCCTACCTGTATCTCAACCAGCGCTACCAGAGCGAGCTGTACGGTTTCTACAG
CAAGGCGATCAACAAGCGCTACCCGTTCAACGCGCACAGCGCCAGCGATGTCGCGGTCAGCGATTTCCGC
GAGTTCTTCAAGGCGCAGGGCGTCGCCGAACGCTTCTTCGAAACCTACATGCGGCCCTTCGTCAGCGGCG
ACCCGGGCAGTTACCGCCTGCGCAGCGTGGACGGTTACAGCCTGCCGATGTCCAAGGTCTATCTCGACCA
GATGGGCACGGCCCAGCTGATCCGCCAGAGCTTCTTCGCCGAGAACCCGGCCGAGCCACAGGTGCGCTTC
CGCCTGGAGCCCTATACCCTCGATCCTGGCGTCAGCCGCGCCGAGTTCCGTTTCGACGGTCAGTCCATGG
AGTACCGCCACGGCCCGATCGTGCCGATGTCGTTCAAGTGGCCCAGCGACGCCGACGGCGGCCGCACCAG
CCTGGTGCTGGAGAAGATGGCCGGACGACCGGTGGGAATCGAACGCAATACCGGGCCCTGGTCGCTGTTC
AGGCTGTTCGACCTGATGCAGACCGAGTACCTCAGCGGGCGTGACGTGATGGTGCTCAAGGCCGACCTGG
GCGGCCTGCGCGCCAACTACCTGCTGCTCGCCCAGCGCACGCCGAATCCGTTCGATCTCGCGGTCCTGCG
CAGCTTCCGCATGCCGGTGCAGCTCTGA
 Primer design