SecReT6
Protein ID: 15596867
SecReT6 ID4
T6SS typei1
Gene symbolstp1
Locus tagPA1670
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H2-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]1822601..1823329 [+]
Productserine/threonine phosphoprotein phosphatase Stp1
NoteStp1
UniProt IDQ9I355
KEGG IDpae:PA1670
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 1.10E-16, Aligned region: 19..204
PP2C [PF00481], Evalue: 3.50E-16, Aligned region: 31..234
SpoIIE [PF07228], Evalue: 5.70E-11, Aligned region: 35..241
Protein Sequence: 242 a.a.     [Download]
>gi|15596867|ref|NP_250361.1| stp1 gene product [Pseudomonas aeruginosa PAO1]
MQRTEPWRSAARTDRGKVRARNEDAFLDCPDRGLWAVADGMGGHQAGDLASRMIVTSLAELPARAGFDER
LNAMRQCLHWLNRRLGEELTLSAERGDRIIGSTVVALVVEGSRAACVWVGDSRCYLWRGQRLYQLSRDHS
LLQRLVDERRMDIEQARAYPSARALTRAVGASEQLVLDVLELEVHPGDVFLLCSDGLYEELSADALGRAL
SLASPQVAVERLFDGALSGAARDNLTAVVIRQ
 
Nucleotide Sequence: 729 bp     [Download]
>gi|110645304|ref|NC_002516.2|:1822601-1823329 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGCAACGCACCGAGCCCTGGCGCAGCGCGGCACGCACGGATCGCGGCAAGGTCCGCGCGCGCAACGAGG
ATGCCTTCCTGGACTGCCCGGATCGCGGGCTCTGGGCGGTCGCCGATGGCATGGGCGGGCACCAGGCCGG
CGACCTGGCCAGCCGGATGATCGTCACCAGCCTGGCGGAACTGCCGGCCCGGGCGGGATTCGACGAGCGC
CTGAACGCGATGCGCCAGTGCCTGCACTGGCTCAACCGGCGCCTGGGCGAGGAACTCACCCTCAGCGCCG
AACGCGGCGACAGGATCATCGGCAGTACGGTGGTGGCGCTGGTCGTGGAGGGTTCGCGGGCGGCCTGCGT
GTGGGTCGGCGACAGCCGCTGCTACCTGTGGCGCGGCCAGCGGCTGTACCAGCTGTCCCGCGACCACTCG
CTGTTGCAGCGACTGGTCGACGAACGGCGGATGGATATCGAGCAGGCCCGCGCCTATCCCTCGGCGCGCG
CGCTGACACGTGCCGTCGGCGCCAGCGAACAACTGGTGCTGGACGTGTTGGAACTGGAGGTGCATCCCGG
GGATGTCTTCCTGCTCTGCAGCGACGGGCTCTACGAAGAGCTGAGCGCCGATGCGCTGGGTCGCGCGTTG
AGCCTGGCATCGCCGCAGGTGGCGGTGGAGCGGCTGTTCGACGGTGCCCTGAGCGGCGCCGCACGGGACA
ACCTGACGGCCGTGGTGATCCGCCAATGA
 Primer design