SecReT6
Protein ID: 15597557
SecReT6 ID5
T6SS typei4a
Gene symbol-
Locus tagPA2361
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H3-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]2608229..2612044 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ9I1B8
KEGG IDpae:PA2361
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.30E-35, Aligned region: 114..354
Protein Sequence: 1271 a.a.     [Download]
>gi|15597557|ref|NP_251051.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MSGATLFMLVLLLVLLALLLGALGWWWRTRGGTEIRSFYAAVRQMEREQGWQGRYEAPWLLMLGNETEGE
QLCSTWRLLPVARPAWFGRWWSDGEGAILLVPESVFLPDEGLRRQSGAWLRLLRLFLRLRGRRALDGVVW
NIPLARLQDGEQAANLGLAARRRYVELTQRLGLSLPVYVVITGMEDLPGFQELLAALPEEARERALGWSS
PFAAEAAWQSRWCEQALEEITATLTESIVELGTLRGQVDNELYCLPPRLESLRGSLQALLEPVFQGNARG
EAPRFRGLYLSGSEAAGAAADEVLPAVDAPRRRSSFASQLWARRILAEEGLAQAVPRILQLRQRWQRGIG
LAALCLCLLWGGLMTWVWRDALRDAGELSQLLHGASERYQPLDDDTRRAAQVRQNVQAWWQLVSQAPRWR
FTSLAFPSSWFSSLDARIDNAYRRVSERLLVRPLRSLLEGEASDLRAIRSDGQPGLKEGDDPSQWKDYLA
AKDLVARATTLERHNRLFAQAIDNRRTPLDDLLQLSNDALGSSYNAGSLARLAYYNRTLFAERPADLAAL
DLGRVAATAADNFHDLMARWLNAYFLTDSLERTGNALTQELAQLGQERDATAAQLLGIGELINHLQQQVN
RINLIWGNGVGQDLVPGYQNLLKSAQQSSLLGNRVEELQNLTVQLQQQFRSEWIAPPEAAGDGLLVKQGA
TLKLADDLLGLKRAIDDLKTKDFVSVALADKTLADHSLLSIDDIGVTQALSFFNDFTGYYESTLPSLNPR
YRYSVLHAAASAATEAMWQSLGPRSRSLASRNASRFDVQVKQVQVLQAALLELQDLQAGARLLLSLNALA
VADIGQALRDIDEQAVLREPVDFSRWSGAPNFGLQMFRAQDSAELKQSLNSQFNAMAAVAERHAPALEWL
QAQQSSLATADYNAFVRFSALNAELQKFKADNPASTAAQLAKLVGNDFNQMDIGSCADILNGVLLPSSRS
DLATRLVDLRQGALGRCQSLQQQQAAQAWKDLADYFNQYLAGRFPFAYSLEAADAEPGRVRHLLQLMETR
LPQVREGLAQVRSPDLPAAEDFVRRLEQAQRWLGPLFERDKSGLLGVALDIDWRSDRSLERGADQVIAWS
LYSGDQESRFPGAQDKGLTWNVGDPLKIMLRWAKNGSQRPADDPRQASLAVADLEAGWSYQGSWALLRMM
RAHFSRQRPPNVDYTEFPLVLQLPVYAPYSPENEARMFLRLSLMSLGGKTPLSIQPLPVRAPQSPFATLL
PATVASTGGTP
 
Nucleotide Sequence: 3816 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c2612044-2608229 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGAGCGGCGCGACGCTGTTCATGCTGGTTCTCCTCCTGGTGCTGCTGGCGCTGCTGCTGGGGGCGCTGG
GCTGGTGGTGGCGAACCCGCGGTGGTACGGAGATCCGCAGCTTCTACGCGGCGGTCCGGCAGATGGAGCG
CGAGCAGGGCTGGCAGGGCCGCTACGAAGCGCCGTGGCTGCTGATGCTCGGCAACGAGACCGAGGGCGAG
CAGTTGTGCTCCACCTGGCGTCTGCTGCCGGTGGCGCGCCCGGCCTGGTTCGGCCGCTGGTGGTCGGACG
GCGAGGGGGCGATCCTGCTGGTGCCCGAGTCGGTGTTCCTGCCCGACGAGGGCCTGCGCCGGCAAAGCGG
CGCCTGGCTGCGCCTGTTGCGTCTGTTCCTGCGCCTGCGCGGCAGGCGCGCGCTGGACGGAGTGGTCTGG
AACATTCCGCTGGCGCGGCTGCAGGATGGCGAGCAGGCGGCCAACCTCGGCCTCGCCGCGCGCCGTCGCT
ACGTGGAACTGACCCAGCGCCTTGGCCTGAGCCTGCCGGTTTACGTGGTGATCACTGGCATGGAAGACCT
GCCTGGCTTCCAGGAACTTCTCGCGGCGCTGCCCGAGGAGGCGCGCGAGCGCGCCCTCGGCTGGTCCTCG
CCGTTCGCCGCCGAAGCGGCCTGGCAGTCGCGCTGGTGCGAGCAGGCGCTGGAGGAAATCACCGCCACCC
TGACCGAGTCGATCGTCGAACTCGGTACCTTGCGCGGCCAGGTGGACAATGAGCTGTATTGCCTGCCGCC
ACGCCTGGAAAGTCTCCGCGGTTCGTTGCAGGCGCTGCTCGAACCGGTCTTCCAGGGCAACGCCAGGGGC
GAGGCGCCGCGCTTTCGCGGTCTCTACCTGAGCGGCAGCGAGGCGGCGGGCGCGGCAGCCGACGAAGTCC
TGCCGGCGGTCGACGCGCCGCGTCGGCGCAGCAGCTTCGCCAGCCAACTGTGGGCACGGCGGATCCTTGC
CGAGGAAGGCCTGGCCCAGGCGGTGCCGCGCATCCTCCAGCTGCGTCAGCGCTGGCAGCGCGGGATCGGC
CTCGCCGCGTTGTGCCTGTGCCTGCTCTGGGGCGGCCTGATGACCTGGGTCTGGCGCGACGCGCTGCGCG
ACGCCGGTGAACTGTCGCAACTGCTGCATGGCGCCAGTGAGCGCTACCAGCCGCTCGACGACGACACTCG
GCGCGCCGCCCAGGTCCGGCAGAACGTCCAGGCCTGGTGGCAACTGGTGTCACAGGCGCCGCGCTGGCGC
TTCACTTCGCTGGCGTTTCCCAGTTCCTGGTTTTCCTCCCTGGATGCACGTATCGACAACGCGTATCGCC
GCGTTTCCGAGCGCCTGCTGGTGCGACCGCTGCGCAGCCTGCTGGAAGGCGAGGCGAGCGACCTGCGGGC
GATCCGCAGCGATGGCCAACCCGGCCTGAAGGAGGGCGACGACCCCAGCCAGTGGAAGGACTACCTGGCG
GCGAAGGACCTGGTCGCCCGCGCCACTACGCTGGAGCGCCACAATCGCTTGTTCGCCCAGGCCATCGACA
ACCGCAGGACGCCGCTCGACGACCTTCTGCAACTGAGTAACGATGCCTTGGGCAGCAGCTACAACGCCGG
CAGCCTGGCGCGCCTGGCCTATTACAACCGCACGCTGTTCGCCGAGCGTCCGGCCGATCTCGCCGCCCTC
GACCTGGGCCGGGTCGCCGCCACGGCGGCGGATAACTTCCATGACCTGATGGCACGCTGGCTGAACGCCT
ACTTCCTCACCGACAGCCTGGAACGCACCGGCAATGCCCTGACCCAGGAACTCGCGCAGCTCGGCCAGGA
ACGAGACGCCACGGCGGCCCAGTTGCTGGGGATCGGCGAATTGATCAACCACCTGCAGCAACAGGTCAAC
CGCATCAACCTGATCTGGGGCAATGGCGTCGGCCAGGATCTCGTCCCTGGCTACCAGAACCTGCTCAAGA
GCGCCCAGCAAAGCAGCTTGCTGGGAAACCGCGTGGAGGAACTGCAGAACCTCACCGTGCAGTTGCAGCA
GCAGTTTCGCAGCGAATGGATCGCGCCTCCGGAGGCTGCCGGCGACGGCCTGCTGGTGAAACAGGGGGCG
ACGCTCAAGCTGGCCGATGACCTGCTCGGTCTGAAACGCGCCATCGATGACCTGAAGACCAAGGACTTCG
TCTCCGTGGCCCTGGCGGACAAGACACTGGCGGACCACTCCTTGCTGAGCATCGACGATATCGGCGTGAC
TCAGGCGTTGAGCTTCTTCAACGACTTCACCGGCTACTACGAGAGCACCCTGCCATCGCTCAACCCGCGC
TATCGCTATTCGGTCCTGCACGCCGCCGCCAGCGCGGCGACCGAGGCCATGTGGCAAAGCCTCGGGCCGC
GCAGTCGTAGCCTGGCCAGTCGCAATGCCTCGCGTTTCGACGTGCAGGTCAAGCAGGTCCAGGTGTTGCA
GGCGGCGCTGCTGGAGTTGCAGGACCTGCAGGCCGGCGCGCGCCTGCTGCTCAGCCTCAACGCGCTGGCC
GTGGCCGATATCGGCCAGGCCCTGCGCGACATCGACGAGCAGGCGGTGCTGCGCGAGCCGGTCGATTTCA
GCCGCTGGTCGGGCGCGCCGAATTTCGGCCTGCAGATGTTCCGCGCCCAGGACAGTGCCGAGCTGAAGCA
AAGCCTGAACAGCCAGTTCAATGCCATGGCGGCCGTCGCCGAACGCCACGCCCCGGCGCTGGAGTGGTTG
CAGGCGCAGCAATCCAGCCTGGCCACCGCCGACTACAACGCGTTCGTGCGCTTCAGCGCGCTCAACGCCG
AACTGCAGAAATTCAAGGCCGACAACCCGGCGAGCACCGCGGCGCAGTTGGCGAAGCTGGTGGGTAACGA
TTTCAACCAGATGGACATCGGCAGTTGCGCCGACATTCTCAACGGCGTGCTCCTGCCGTCCAGCCGCAGC
GACCTGGCGACGCGCCTGGTGGACCTGCGCCAGGGCGCGCTCGGGCGCTGCCAGTCGTTGCAACAGCAGC
AGGCGGCGCAGGCCTGGAAGGACCTCGCCGACTACTTCAACCAGTACCTCGCCGGACGCTTCCCGTTCGC
CTACAGCCTGGAAGCGGCCGATGCCGAGCCGGGGCGGGTGCGGCACCTGCTGCAACTGATGGAGACGCGC
TTGCCGCAGGTGCGCGAAGGGCTGGCCCAGGTTCGCTCGCCGGACCTGCCGGCCGCCGAGGACTTCGTCC
GCCGCCTGGAGCAGGCGCAGCGCTGGCTCGGCCCGCTGTTCGAGCGCGACAAGTCGGGCCTGCTCGGCGT
CGCCCTGGACATCGACTGGCGCAGCGACCGCAGCCTGGAACGCGGCGCCGACCAGGTGATCGCCTGGAGC
CTGTACTCGGGCGACCAGGAAAGCCGTTTCCCCGGCGCGCAGGACAAGGGCCTGACCTGGAATGTCGGCG
ATCCGCTGAAAATCATGCTGCGCTGGGCGAAGAACGGCTCGCAGCGTCCGGCAGACGACCCGCGCCAGGC
CAGCCTGGCGGTGGCCGACCTCGAGGCCGGCTGGAGCTACCAGGGCTCCTGGGCGCTGTTGCGCATGATG
CGCGCGCACTTCTCCCGGCAGCGCCCGCCGAACGTCGACTACACGGAGTTTCCGCTGGTCCTGCAACTGC
CGGTGTATGCGCCCTACAGCCCGGAAAACGAGGCGCGGATGTTCCTCCGCCTGTCGTTGATGAGCCTGGG
CGGCAAGACCCCGCTGTCCATCCAGCCGCTGCCGGTGCGCGCGCCGCAATCGCCGTTCGCGACGCTGTTG
CCGGCCACCGTCGCCAGCACCGGAGGTACCCCATGA
 Primer design