SecReT6
Protein ID: 156932367
SecReT6 ID226
T6SS typei2
Gene symbol-
Locus tagESA_00142
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]126211..129339 [+]
Producthypothetical protein
NoteTssM
UniProt IDA7MMD4
KEGG IDesa:ESA_00142
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-60, Aligned region: 36..362
Phage_GPD [PF05954], Evalue: 1.40E-60, Aligned region: 520..574
IcmF-related [PF06761], Evalue: 2.30E-50, Aligned region: 462..644
DUF1215 [PF06744], Evalue: 5.80E-33, Aligned region: 762..883
Phage_base_V [PF04717], Evalue: 1.70E-11, Aligned region: 354..390
Phage_base_V [PF04717], Evalue: 1.70E-11, Aligned region: 413..470
Phage_base_V [PF04717], Evalue: 1.70E-11, Aligned region: 974..990
Protein Sequence: 1042 a.a.     [Download]
>gi|156932367|ref|YP_001436283.1| hypothetical protein ESA_00142 [Cronobacter sakazakii ATCC BAA-894]
MMTTTSPVLDALSLNRYHLKIKGCTAPLDVESFEGREGLSTRYRYDVRLTSSDKDIDPAMMLMKNVTFIM
QTLPQTAFRRTLAPEVQRTLYGVITHFSRLSVSRDEATYSLTFEPRLSLLDNSRRSAIYQNLSVPEVVEK
ILREHHNWPGWLFEFRLSNTYPSREIITQFMLSDAEFIDRLLSEVGIWYNFTQDIETGHEMVVFGDSDRG
WQYGVTVPVVNLAGMHDNRAESVWNLQAHHQVTERSVSTHDYNYRTADVIMNADADLTHDDDKTTYGNDY
HYTDGFLSEGEQYATAGNQSAESGYFYARLRHERQLNRQHRLSLESNSTLIAPGQVLKAQGDNSRAFAEG
MLVTAIETSASRSSHYRLKAKGIAYRSTVCFRPVHQPRARITVPLTARITSSQAGDIYSHIDKQGRYRVR
FDFDKDSWPQGGESPWLRRARDYAGDNFGLHLPLIQGTEVAVMFDGGHPDWKISADPQLVSITRSALLRL
IGQRNAESALYQKMLQQVSHNYADMRLSDMTGDTDASRLFTTDEVVPGMFTRDAWDNAVQPAIDKVVNER
RDEIDWVLTDSKHQVASDISPAALKARLTERYFTDYAGAWLDFLNSLHWQNAATLSDAIDQLTLLADVRQ
SPLVALMNTLNVQGRAGQTQEALSDSLVKSAQNLLHSDGAKAIDQQAGPHGPLEATFGPTLALLSNQNGG
SDSLSLQTFLTRVTRVRLKLQQVTNTADPQAMMQALAQTVFQGKSVDVTDTRDYGSLVAASLGQEWGGFG
QALFVQPMEQAWQQVLAPTAESINSQWQQTIVNDWEHDFNDRWPFSPDKQSEASLPLLSQYLRNDTGRIT
QFVKTSLGGVLHKEGRRWVPDAISSQGLHFNPEFLDALNALSELADVVFTSGDAGVHFQLMGKPARDVMQ
TTLFLDQQKLDYHNQVESWQPFVWPDSQWKPRTTLTWTSVNTGERIYADYPGSWGFIRLLDKAQVKATDN
STYVLRWKTADGDTLNMILRTEAGVGPLALLRLKGFRLPQQVFETTGAMATRHTESDAGSEE
 
Nucleotide Sequence: 3129 bp     [Download]
>gi|156932229|ref|NC_009778.1|:126211-129339 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGATGACGACTACATCCCCTGTTCTGGATGCGCTAAGCCTCAATCGCTACCACCTCAAAATTAAGGGCT
GCACTGCGCCGCTGGACGTGGAGTCATTTGAAGGTCGCGAAGGGTTAAGCACCCGTTATCGTTATGACGT
GCGACTTACCAGCAGCGATAAGGATATCGATCCGGCGATGATGCTGATGAAGAATGTTACCTTCATCATG
CAGACTCTGCCGCAGACGGCGTTTCGCCGTACCCTTGCCCCGGAAGTCCAGCGGACGCTGTATGGCGTAA
TCACTCACTTTTCCCGCCTTTCCGTTTCGCGTGATGAAGCCACATACAGCCTGACGTTTGAACCGCGCCT
TTCGCTGCTTGATAACAGCCGCCGTAGCGCCATCTACCAGAACCTGTCCGTCCCGGAAGTGGTGGAGAAA
ATTCTGCGTGAACACCACAACTGGCCGGGTTGGCTGTTTGAGTTTCGCCTGAGTAATACGTATCCGTCGC
GGGAAATTATTACCCAGTTTATGTTGTCGGATGCAGAGTTTATCGACCGTCTGCTCTCGGAAGTGGGCAT
CTGGTATAACTTTACCCAGGACATCGAGACCGGGCATGAAATGGTGGTGTTCGGCGATTCAGACCGGGGC
TGGCAGTATGGCGTCACTGTTCCGGTGGTGAACCTGGCGGGCATGCACGATAACCGCGCGGAATCGGTGT
GGAATTTACAGGCACACCATCAGGTGACGGAGCGCTCGGTCAGTACACACGATTACAACTACCGTACCGC
TGATGTCATCATGAATGCGGATGCCGACCTGACTCACGATGACGACAAAACCACGTACGGTAATGACTAC
CACTATACCGATGGTTTTCTTAGCGAAGGCGAGCAGTACGCCACGGCGGGGAACCAGAGTGCTGAAAGCG
GGTATTTTTATGCCCGCCTGCGCCACGAACGCCAGCTGAACCGCCAGCACCGCCTCAGCCTTGAAAGCAA
CTCCACGCTTATTGCCCCGGGCCAGGTGCTGAAGGCCCAGGGCGACAATTCCCGCGCCTTTGCCGAGGGC
ATGCTGGTGACCGCCATAGAAACTTCCGCCAGCCGGAGTTCGCACTATCGGCTTAAAGCTAAAGGGATAG
CGTACCGGAGTACGGTCTGCTTCCGCCCGGTCCATCAGCCCCGCGCCCGTATTACCGTTCCGCTGACGGC
GCGCATCACCAGTTCGCAGGCGGGTGATATCTACAGCCATATCGATAAACAGGGCCGCTACCGGGTTCGC
TTCGATTTTGATAAGGACAGCTGGCCGCAGGGCGGTGAAAGCCCGTGGCTCAGACGCGCCCGCGATTACG
CCGGAGATAACTTCGGGCTGCATCTGCCGCTGATACAGGGCACCGAAGTGGCGGTGATGTTCGACGGCGG
TCACCCGGACTGGAAAATCTCCGCTGACCCGCAACTGGTCTCCATCACACGCAGCGCGCTGCTGCGCCTG
ATTGGTCAGCGTAACGCGGAATCGGCGCTTTATCAGAAGATGCTGCAACAGGTATCGCATAACTACGCCG
ATATGCGTCTCTCCGACATGACCGGCGATACCGATGCCTCGCGTCTGTTTACCACGGATGAAGTGGTGCC
AGGGATGTTCACCCGCGACGCCTGGGACAACGCCGTACAGCCTGCCATTGATAAGGTGGTGAATGAGCGC
CGGGATGAAATCGACTGGGTACTGACCGACAGCAAACACCAGGTGGCCTCTGATATTTCACCGGCGGCGC
TTAAGGCCCGCCTGACAGAGCGCTACTTTACCGATTACGCCGGAGCCTGGCTTGATTTCCTCAACAGCCT
GCACTGGCAGAATGCCGCCACGCTCTCGGATGCGATTGACCAGCTGACATTGCTCGCTGACGTGCGCCAG
TCACCGCTGGTGGCGCTGATGAACACCCTGAACGTGCAGGGCCGTGCCGGTCAGACGCAGGAAGCGCTTT
CTGATTCACTGGTGAAATCGGCACAAAACCTGCTGCACAGCGATGGCGCAAAGGCCATCGACCAGCAGGC
GGGACCGCATGGGCCGCTGGAAGCGACCTTTGGCCCGACGCTTGCGCTACTCAGCAACCAGAACGGTGGC
AGCGACAGCCTGAGCCTGCAGACCTTCCTCACCCGCGTGACCCGCGTTCGCCTCAAACTTCAGCAGGTAA
CCAATACTGCTGACCCGCAGGCGATGATGCAGGCGCTGGCGCAGACCGTGTTCCAGGGCAAATCGGTGGA
TGTGACCGACACCCGCGATTACGGCAGCCTGGTAGCGGCCAGCCTCGGTCAGGAGTGGGGCGGTTTTGGC
CAGGCGCTGTTTGTTCAGCCGATGGAGCAGGCCTGGCAACAGGTGTTAGCCCCGACGGCAGAGAGCATTA
ACAGCCAGTGGCAGCAGACCATTGTGAACGACTGGGAACATGATTTTAACGACCGCTGGCCGTTCTCGCC
TGACAAACAGAGTGAGGCTTCGCTGCCGCTGCTTTCGCAATACCTGCGTAACGACACCGGGCGTATCACT
CAATTTGTGAAAACCAGCCTCGGCGGTGTGCTGCATAAAGAAGGCCGTCGCTGGGTGCCGGATGCCATCA
GCAGCCAGGGGCTGCACTTCAATCCAGAATTTCTGGATGCGCTGAATGCGCTCAGCGAACTGGCTGATGT
GGTGTTCACCAGCGGCGATGCCGGCGTGCATTTTCAGCTGATGGGTAAACCGGCCCGTGACGTGATGCAG
ACCACGCTGTTCCTCGACCAGCAAAAACTGGATTACCACAACCAGGTAGAGAGCTGGCAGCCGTTTGTCT
GGCCGGACAGCCAGTGGAAGCCGCGCACCACGCTTACCTGGACCAGTGTGAACACTGGCGAGCGTATTTA
CGCTGATTACCCCGGAAGCTGGGGCTTTATCCGTCTGCTGGATAAGGCGCAGGTGAAGGCAACGGACAAC
AGTACCTATGTCCTGCGCTGGAAAACAGCAGACGGCGACACGCTGAACATGATACTGCGCACGGAGGCGG
GCGTTGGCCCGCTGGCGCTGCTGAGACTGAAAGGGTTCAGGCTGCCGCAGCAGGTGTTTGAAACCACGGG
CGCAATGGCAACCCGCCATACAGAGAGCGATGCCGGAAGTGAGGAGTAA
 Primer design