SecReT6
Protein ID: 156934212
SecReT6 ID226
T6SS typei2
Gene symbol-
Locus tagESA_02041
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]1976281..1977651 [-]
Producthypothetical protein
NoteTssM
UniProt IDA7MFA0
KEGG IDesa:ESA_02041
PDB IDNA
Domain hit(s) vs Pfam DUF1215 [PF06744], Evalue: 3.40E-35, Aligned region: 179..300
IcmF-related [PF06761], Evalue: 3.40E-13, Aligned region: 2..58
IcmF-related [PF06761], Evalue: 3.40E-13, Aligned region: 65..89
Protein Sequence: 456 a.a.     [Download]
>gi|156934212|ref|YP_001438128.1| hypothetical protein ESA_02041 [Cronobacter sakazakii ATCC BAA-894]
MTARYFTDFGNAWLNMVNSIQWIEADSLSDSIAQLNLLADVRQSPLVALMNTLNYQGKTGQQREALADSL
VESAKNLIGKKKNTKAILKQAQGPEGPLDNVFGPLTGLMEGKDGAGASGNLSFQSWLSRVTQVRLKLQQI
TSAPDPQAMAQMLAQTVFEGKAIDLTDTRDYGSLVAASLGQEWSGFGQALFVQPLDLAWRQVLAPAASGL
NERWKTTIVEQWNTAFAGRYPFKATGSDASLPILAQFLRADSGRIATFLKNNLGGILHQEGNRWVVDPSA
SQGMTVNPAFLAAINQLATIADTVFAQGDAGVRFELMARPSRDVARMQLTLDGQKLDYFNQMESWRSFSW
PGETWYPGVDLSWRTVTSGMQLYSNNAGKWGFIRLLGKAQITPVDSSRIQLVWVAPDGSPLKFIMRTELG
DGPLALLRLQGFTLPETIFSKQEIVPTDDEPEQGVE
 
Nucleotide Sequence: 1371 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c1977651-1976281 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGACCGCGCGTTACTTTACTGACTTCGGTAATGCCTGGCTCAATATGGTCAACAGCATCCAGTGGATTG
AAGCTGATTCGCTATCAGATTCAATTGCCCAACTGAACCTGCTGGCCGATGTGCGCCAGTCTCCGCTGGT
AGCGCTAATGAACACCTTAAACTATCAGGGAAAAACCGGTCAGCAGCGTGAGGCGCTGGCGGATTCTCTG
GTGGAATCCGCAAAAAATCTGATAGGTAAAAAGAAAAACACCAAAGCCATTCTTAAACAGGCGCAGGGGC
CGGAAGGACCGCTGGATAACGTCTTCGGCCCGTTAACCGGGCTGATGGAAGGTAAGGATGGGGCGGGCGC
GAGCGGTAATCTCAGCTTCCAGTCCTGGCTTTCGCGCGTGACGCAGGTGCGTCTTAAGCTTCAGCAGATA
ACGAGCGCTCCGGACCCGCAGGCGATGGCGCAAATGCTGGCGCAGACGGTTTTCGAAGGTAAGGCCATCG
ATCTGACGGATACCCGAGATTACGGCAGCCTGGTGGCAGCGAGCCTCGGGCAGGAGTGGAGCGGTTTCGG
CCAGGCATTGTTTGTTCAGCCGCTGGATCTGGCCTGGCGGCAGGTTCTTGCCCCGGCGGCCAGTGGGCTG
AACGAGCGCTGGAAGACCACCATTGTTGAACAATGGAATACCGCATTTGCAGGACGTTATCCCTTTAAAG
CCACCGGCAGCGATGCCTCACTGCCCATACTGGCGCAGTTTTTACGCGCTGACTCCGGGCGTATCGCCAC
GTTTCTGAAAAATAATCTCGGCGGAATTTTGCATCAGGAAGGCAACCGCTGGGTAGTTGACCCTTCAGCC
AGCCAGGGAATGACGGTGAATCCGGCGTTTCTGGCGGCGATTAATCAACTGGCGACTATCGCAGATACGG
TCTTCGCGCAGGGTGATGCCGGGGTACGCTTTGAGCTGATGGCCCGTCCGTCTCGCGATGTTGCCCGAAT
GCAGTTGACCCTGGATGGGCAAAAGCTCGATTACTTCAACCAAATGGAAAGCTGGCGAAGCTTTAGCTGG
CCTGGAGAGACATGGTATCCGGGCGTCGATCTCAGCTGGCGTACCGTCACCAGCGGTATGCAGCTTTACA
GTAATAACGCCGGTAAATGGGGGTTCATTCGTCTGTTAGGCAAAGCGCAAATAACGCCAGTCGACAGCAG
CCGGATACAGCTCGTGTGGGTCGCGCCAGACGGCAGCCCGCTTAAATTTATTATGCGTACTGAACTGGGC
GACGGCCCGCTTGCGTTACTGAGGCTGCAAGGATTTACGCTGCCTGAAACCATTTTCAGCAAGCAAGAAA
TAGTGCCCACGGATGATGAGCCAGAACAAGGAGTTGAATAA
 Primer design