SecReT6
Protein ID: 156936009
SecReT6 ID227
T6SS typei3
Gene symbol-
Locus tagESA_03903
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]3847803..3852350 [-]
Producthypothetical protein
NotePAAR
UniProt IDA7MQ50
KEGG IDesa:ESA_03903
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 479..541
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 527..552
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 586..600
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 628..660
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 650..681
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 698..724
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 709..743
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 751..788
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 795..820
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 836..869
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 877..908
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 921..940
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 982..1016
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 1048..1077
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 1067..1107
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 1094..1137
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 1123..1152
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 1143..1186
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 1172..1200
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 1193..1225
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 1293..1308
RHS_repeat [PF05593], Evalue: 5.80E-58, Aligned region: 1357..1378
AHH [PF14412], Evalue: 9.40E-23, Aligned region: 1403..1512
RHS [PF03527], Evalue: 1.90E-13, Aligned region: 661..674
RHS [PF03527], Evalue: 1.90E-13, Aligned region: 773..788
RHS [PF03527], Evalue: 1.90E-13, Aligned region: 872..886
RHS [PF03527], Evalue: 1.90E-13, Aligned region: 1285..1322
PAAR_motif [PF05488], Evalue: 2.50E-10, Aligned region: 89..116
PAAR_motif [PF05488], Evalue: 2.50E-10, Aligned region: 197..244
DUF4150 [PF13665], Evalue: 0.0031, Aligned region: 94..122
DUF4150 [PF13665], Evalue: 0.0031, Aligned region: 209..241
Protein Sequence: 1515 a.a.     [Download]
>gi|156936009|ref|YP_001439925.1| hypothetical protein ESA_03903 [Cronobacter sakazakii ATCC BAA-894]
MSELLAARIDDPLIHSSLLADVVSGAVEGAICLAAITAGSAMMGTGLGTVAGVVLIAAVFTTGIAEDAGD
LVGQGVDAVLDFFGWLGPPDAIIKTGSHNVRIMEKAAARAAGTVDHNYLNTPIPQESFGDQAKAFAIGTA
VAILEVAQFTLHPLDNLAAGASAIASSGWDGVKKFAGSVWDNFTQPVVAGASPYAKAAPGDIVVCTKGHT
VAGTNYLAEGSKKVLINGQPASRNGDRSTCEAKVKVKENTRVRIGGESIVVRDIRSGKNFWARLIGNTIG
SLGPAIIRNLSKGMLKTLFSRQIMKTFCCQFAADLGMGLTTFGLIQAGKVGSEARQTQHPVDIASGAKIL
AGGEDRDFTLEDRIPLIWQRVYNSRNLATGMLGTGWLLPFETRFFRLENNQFIWRDMSGRELGFGELTPG
DVVDYLEDGVTLYYTVSGTLMLQMTSGEYHVYEPDPTRPGEWRLFRIYDRHENCQYYSWDEHGRLARISG
DNEALDVELAYEKTHGRLASVHQVCNGERRLLVTYGYNEHGQLTDVTDADGIVTRRFGWDRASDMMGWHS
YSTNLSVHYQWQPAADAPNWRVCGYQVLDDQGNVLERWRIDADEAKRCATVSCDAGFSTRHCWDYLYRIT
EYTDRHGGVWRYEWADYAELLTAATTPDGSRWVYGHDEHGNLTEVRDPLGNSTFTTWHPVFAFPVKEVLP
DGATWQYEYNPRGDVVSLTDPKGGVTRFEWNEQGDLVQQTDALNNTHRFWWNERGQLVRDEDCSGNQSQR
LYDAAGRPLSASDAEGNTDRWTLTAAGRLRTWRRADGRETHYEYDNAGLLCGQDDDGLRERKVTRNARGQ
VVSAADPAGHLTRLRYDRFGHLTTLVNPNRESWRFEYDAAGRLTGQRDYAGRLTEYRHDALGQVTEVIRH
PLPGSADAPLVTAFEYDVLGRLTARETAEHRTEYRHNTLSLEIRRATRAEWRQALLEEREPAWDAVLVFT
RNAAGELVSEENHGGKFEYEYDALGNLSSTTFPDGRELATLRYGTGHLLEMQLRHGGAMHTLAAYGRDRL
HREISRSQGVLSQETRYDAAGRVTQRTVLDARRELVFERRYRWDRTDQIVQQIHTDTTPATPGEKYSQYL
WGYDAAGQVTKAVEPQKEERFFWDPAGNRTEEHRNPVWHNLLLRLDGLKLDYDGFGRLTRRQDKSGVIQQ
FTYDDEQRVKEIRFEGNAEFRRVEYRYDPLGRRTHKVLWRYGEKAPETIRFDWQGLQLAGEQSDREPDHY
VQYVYTEGSYEPLARVDSVFDDCEIYWYHTELNGLPERVTDADGQTVWRGQFSTWGETERELSVPQWQVP
QNLRFQGQYLDRESGLHYNLFRYYDPVVGRYTQMDPIGLAGGMNTYSYVGDPLTWVDPLGLMSCGSDAVL
LRQNMIREGIEEPSFKNSAHHIVMSNSTDARMVALRQKIEDFDLDINGSYNGVFLPTSSKVKVASGTSLP
AHSKIHTNTYKQNVYERLINIDNAEEFVSELENISNMIMKNKFEF
 
Nucleotide Sequence: 4548 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c3852350-3847803 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
GTGTCCGAACTGTTAGCTGCCCGTATAGATGATCCGCTCATCCACAGCTCTCTGCTCGCCGATGTCGTCA
GTGGCGCGGTGGAGGGGGCTATCTGTCTTGCCGCCATAACGGCGGGTTCGGCGATGATGGGCACGGGGCT
GGGTACGGTTGCGGGCGTTGTATTGATTGCGGCCGTATTCACCACGGGTATTGCAGAGGACGCCGGCGAT
CTGGTGGGGCAAGGCGTCGATGCTGTGCTGGATTTCTTCGGCTGGCTCGGCCCGCCGGATGCGATTATCA
AGACAGGCTCTCACAACGTACGCATTATGGAAAAAGCCGCCGCGCGCGCGGCGGGCACGGTTGATCACAA
CTATCTCAATACGCCCATCCCGCAAGAGAGCTTTGGTGATCAGGCGAAGGCATTTGCGATAGGCACCGCG
GTTGCCATTCTCGAAGTGGCGCAGTTTACCCTGCACCCGCTGGATAACCTGGCGGCAGGAGCAAGCGCCA
TCGCCAGCAGCGGCTGGGACGGAGTAAAAAAATTCGCGGGCAGCGTCTGGGATAACTTCACGCAACCCGT
CGTGGCGGGTGCCAGCCCGTACGCTAAGGCGGCGCCGGGCGATATCGTGGTGTGCACCAAAGGCCATACG
GTGGCCGGCACCAACTACCTGGCGGAAGGCTCGAAAAAAGTGCTGATCAATGGCCAGCCCGCGAGCCGCA
ACGGCGATCGCAGCACCTGCGAAGCCAAAGTCAAAGTTAAAGAAAACACGCGCGTGCGCATCGGCGGCGA
AAGCATCGTGGTGCGCGATATCCGCAGCGGTAAGAATTTCTGGGCGCGGCTTATTGGCAACACCATCGGC
AGCCTTGGCCCGGCGATTATCCGCAACCTCAGCAAAGGGATGCTGAAGACACTCTTCAGCCGCCAGATCA
TGAAAACCTTTTGCTGCCAGTTTGCCGCCGATCTCGGCATGGGCCTGACGACATTCGGGCTGATTCAGGC
AGGCAAAGTGGGCAGCGAGGCGCGCCAGACGCAGCACCCGGTGGATATCGCCAGCGGCGCGAAAATTCTC
GCGGGCGGCGAAGACCGCGATTTCACGCTGGAAGACCGCATTCCGCTCATCTGGCAGCGTGTCTACAACA
GCCGCAACCTGGCGACCGGTATGCTCGGCACCGGCTGGCTGCTGCCGTTTGAGACCCGCTTCTTCCGCCT
TGAGAACAATCAGTTTATCTGGCGCGATATGTCGGGCCGCGAGCTGGGCTTCGGCGAGCTGACCCCCGGC
GACGTGGTGGATTATCTCGAAGACGGCGTCACGCTCTATTACACCGTCAGCGGCACGCTGATGCTCCAGA
TGACGAGCGGCGAGTACCACGTCTACGAACCGGACCCGACGCGTCCGGGCGAGTGGCGGCTGTTCCGTAT
CTACGATCGTCACGAGAACTGCCAGTACTACAGCTGGGATGAACACGGCAGGCTGGCGCGGATTTCCGGC
GACAACGAAGCGCTGGATGTCGAACTGGCGTATGAGAAAACGCATGGCCGTCTCGCCAGCGTGCATCAGG
TATGCAACGGCGAGCGCCGCCTGCTGGTGACTTACGGTTATAACGAACACGGCCAGTTGACTGACGTGAC
CGACGCGGACGGCATCGTCACGCGCCGCTTCGGCTGGGATCGCGCCAGCGACATGATGGGCTGGCACAGC
TATTCCACCAACCTGAGCGTGCATTATCAGTGGCAGCCCGCCGCCGATGCGCCCAACTGGCGTGTGTGCG
GTTATCAGGTGCTGGATGACCAGGGCAACGTGCTGGAGCGCTGGCGCATCGATGCCGACGAGGCGAAACG
CTGCGCCACGGTCAGCTGCGACGCGGGTTTCTCGACGCGCCACTGCTGGGATTACCTCTACCGCATCACG
GAATACACCGACCGCCACGGCGGCGTGTGGCGCTACGAGTGGGCGGATTATGCCGAGCTGCTGACCGCGG
CCACCACGCCGGACGGCAGCCGCTGGGTATACGGCCACGACGAACACGGCAACCTGACGGAAGTGCGCGA
CCCGCTCGGCAACAGCACGTTCACCACGTGGCACCCGGTGTTCGCGTTCCCGGTGAAAGAGGTGCTGCCG
GACGGCGCCACCTGGCAGTACGAATACAACCCGCGCGGCGATGTGGTCTCGCTCACCGACCCGAAAGGCG
GCGTGACGCGCTTTGAGTGGAACGAGCAGGGCGACCTGGTTCAGCAGACCGACGCGCTGAACAACACGCA
CCGGTTCTGGTGGAACGAGCGCGGGCAGCTGGTACGCGACGAGGACTGCTCCGGCAACCAGAGCCAGCGG
CTTTATGACGCGGCGGGGCGACCGCTCAGCGCCAGCGACGCCGAAGGCAACACCGACCGCTGGACGCTGA
CTGCGGCAGGGCGTCTGCGCACCTGGCGGCGGGCGGACGGCCGCGAGACGCACTACGAATATGACAACGC
CGGGCTGCTGTGCGGCCAGGACGATGACGGTCTGCGCGAGCGTAAGGTGACGCGCAACGCGCGCGGCCAG
GTGGTGAGCGCCGCCGACCCGGCGGGCCACCTGACGCGCCTGCGTTACGACCGCTTCGGCCACCTGACGA
CGCTGGTGAACCCGAACCGCGAGAGCTGGCGGTTTGAGTATGACGCCGCAGGCCGCCTGACGGGCCAGCG
GGACTACGCGGGCCGCCTGACGGAGTACCGCCACGACGCGCTGGGCCAGGTGACAGAGGTGATTCGCCAT
CCGCTGCCGGGCAGCGCGGACGCGCCGCTGGTGACTGCGTTTGAATATGACGTGCTGGGCCGCCTGACTG
CACGCGAAACCGCAGAGCACCGCACCGAGTACCGCCACAACACGCTGTCGCTGGAAATCCGCCGCGCCAC
GCGCGCCGAATGGCGGCAGGCGCTGCTTGAAGAGCGCGAGCCTGCGTGGGACGCCGTGCTGGTCTTCACC
CGAAACGCCGCGGGCGAGCTGGTGAGCGAGGAGAACCACGGCGGGAAGTTTGAGTATGAGTACGATGCAC
TCGGCAACCTCAGCAGCACAACATTCCCGGATGGCCGCGAACTCGCCACGCTGCGCTACGGCACCGGTCA
TCTGCTGGAGATGCAGCTGCGCCACGGCGGGGCAATGCACACGCTGGCGGCGTACGGCCGTGACCGGCTG
CACCGGGAAATCTCGCGCAGCCAGGGCGTGCTCTCGCAGGAGACCCGTTACGACGCCGCAGGGCGCGTCA
CGCAGCGCACGGTGCTGGACGCCCGCCGTGAACTGGTGTTTGAGCGCCGCTACCGCTGGGACCGCACCGA
CCAGATAGTCCAGCAGATACACACCGACACCACGCCTGCAACACCGGGCGAGAAATACAGCCAGTACCTG
TGGGGCTACGATGCCGCCGGTCAGGTCACAAAAGCCGTTGAACCGCAGAAAGAAGAACGCTTCTTCTGGG
ACCCGGCAGGTAACCGCACTGAGGAGCACCGCAACCCGGTGTGGCACAACCTGCTGCTGCGCCTCGACGG
GCTGAAGCTGGACTATGACGGGTTTGGCAGGCTAACGCGCCGTCAGGATAAAAGCGGTGTTATCCAGCAG
TTCACGTATGACGATGAGCAGCGGGTGAAGGAAATCCGGTTTGAGGGGAACGCAGAGTTCCGCCGTGTGG
AGTACCGCTATGACCCGCTTGGCCGCAGGACGCATAAGGTTCTGTGGCGTTACGGTGAGAAAGCCCCGGA
GACCATCCGCTTTGACTGGCAGGGCTTACAGCTCGCCGGTGAACAGAGCGACCGCGAGCCGGACCACTAC
GTTCAGTACGTCTACACCGAAGGCAGCTACGAACCGCTGGCGCGGGTCGACAGCGTTTTCGATGACTGCG
AAATTTACTGGTACCACACCGAACTCAACGGCCTGCCGGAGCGGGTGACCGACGCGGACGGGCAGACGGT
CTGGCGCGGGCAGTTCAGCACCTGGGGCGAAACCGAACGCGAACTCAGCGTGCCGCAGTGGCAGGTGCCG
CAGAACCTGCGCTTCCAGGGCCAGTACCTCGACCGTGAAAGCGGGCTTCACTACAACCTGTTCCGCTATT
ACGACCCGGTGGTCGGACGTTACACCCAGATGGACCCGATTGGGTTAGCGGGCGGGATGAACACGTATTC
CTACGTGGGTGATCCGCTGACGTGGGTGGATCCGCTGGGGTTAATGAGCTGTGGCTCAGACGCTGTTCTG
TTACGACAAAATATGATCCGTGAGGGTATCGAAGAGCCATCTTTCAAAAATAGTGCGCACCATATTGTTA
TGTCTAATTCAACAGACGCACGGATGGTTGCATTAAGACAGAAAATAGAAGACTTCGATCTTGATATAAA
TGGATCTTATAATGGCGTATTTTTACCAACGTCATCAAAGGTTAAAGTTGCTTCTGGAACAAGCTTGCCT
GCGCATAGCAAAATCCATACAAATACCTATAAGCAAAATGTTTATGAAAGACTTATTAATATTGATAATG
CTGAAGAATTTGTTTCGGAATTAGAAAATATTAGCAATATGATTATGAAAAATAAATTTGAATTTTGA
 Primer design