SecReT6
Protein ID: 156936011
SecReT6 ID227
T6SS typei3
Gene symbol-
Locus tagESA_03905
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]3852781..3854721 [-]
Producthypothetical protein
NoteTssI
UniProt IDA7MQ52
KEGG IDesa:ESA_03905
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.60E-73, Aligned region: 25..330
Phage_GPD [PF05954], Evalue: 1.60E-73, Aligned region: 516..555
Phage_base_V [PF04717], Evalue: 4.00E-24, Aligned region: 368..461
Protein Sequence: 646 a.a.     [Download]
>gi|156936011|ref|YP_001439927.1| hypothetical protein ESA_03905 [Cronobacter sakazakii ATCC BAA-894]
MEVMLNRITVQLPVEGLLFWKLSGREALSEPFMFTLTLLGTDARADRSALLGQPVTVTIPTQALMTPRYL
NGKVTRVAVSAVELSGTRYAAYELTVEPDLWPMQRDRNLRIFQGQTVPQIVKTLLGESRVNMEERLSGSY
RVWEYCVQYQESSLDFISRLLELEGIAYHFRHEQDRHTLILTDAPGQYEPFPGYETIPYHVTPSGGSTDE
EGISQWALEDSVTPGIYSLDDYDFRKPNAWLFQARQNPLSPQPGSIDVYDWPGRFVEHGHGEFYARIRQE
RWQVEHRQTQGTATALGIAPGHTFVLRNAPFFGDNGEYLTTIAHYRFEENRYASGPDSNTLHEIRFEVIP
ADVPYRPAQKTPWPRTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLGKGDDTSSSWVRVSSAWAGQG
FGGVQIPRVGDEVVVDFINGDPDRPLITGRVYNEASMPPWALPAAATQMGFLSRSKDGSPDNANALRFED
KAGEEQVWLQAERNLDTKVKKDETHSVGGSRILSVKQDYTGKVEGKQEHAIQMSRNELVGGQYDIKGQGT
VTVSSATGIRLVTGDSVLEMSANGEVNLYCTKFAINASGTGQINTGGTLDLNLKNEPDKASNVAPTPGDI
QNEVAKTFNSDGEGQA
 
Nucleotide Sequence: 1941 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c3854721-3852781 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGGAAGTTATGCTCAACCGAATCACCGTTCAGCTCCCGGTCGAGGGGCTGCTTTTCTGGAAACTCTCCG
GGCGCGAGGCGCTGTCGGAGCCGTTCATGTTCACCCTGACGCTGCTCGGCACCGATGCGCGCGCCGACCG
CAGCGCGCTGCTGGGGCAGCCGGTGACGGTGACCATCCCGACCCAGGCGCTGATGACGCCGCGCTACCTC
AACGGCAAGGTGACCCGCGTGGCGGTGAGCGCGGTGGAGCTGTCCGGCACCCGTTATGCGGCCTATGAGC
TGACGGTGGAGCCGGACCTGTGGCCGATGCAGCGCGACCGCAACCTGCGTATCTTCCAGGGGCAGACGGT
GCCGCAGATAGTGAAAACGCTGCTGGGCGAAAGCCGGGTGAACATGGAAGAGCGCCTTTCCGGCAGCTAC
CGCGTCTGGGAATACTGCGTGCAGTACCAGGAGAGCAGCCTGGACTTCATCAGCCGTCTGCTGGAGCTGG
AGGGCATCGCCTACCACTTCCGCCACGAGCAGGACCGCCACACGCTCATCCTCACCGATGCCCCCGGCCA
GTACGAGCCGTTCCCCGGCTACGAGACCATTCCGTACCATGTGACCCCTTCAGGCGGCAGCACAGACGAA
GAGGGCATCAGCCAGTGGGCGCTGGAAGACAGCGTGACGCCGGGCATCTACAGCCTCGACGACTACGACT
TCCGCAAGCCGAACGCCTGGCTGTTCCAGGCGCGGCAGAACCCGCTGTCGCCGCAGCCGGGGAGTATTGA
CGTTTACGACTGGCCGGGCCGTTTTGTGGAGCACGGTCACGGCGAGTTCTACGCCCGCATCCGCCAGGAG
CGCTGGCAGGTGGAGCACCGCCAGACGCAGGGCACCGCGACGGCGCTCGGCATCGCGCCCGGCCACACCT
TTGTGCTGCGCAACGCCCCGTTCTTCGGCGACAACGGCGAGTACCTCACCACCATCGCCCACTACCGCTT
CGAGGAGAACCGCTACGCCAGCGGCCCGGACAGTAACACACTGCACGAAATCCGCTTTGAGGTGATACCG
GCGGACGTGCCGTACCGCCCGGCGCAGAAGACGCCGTGGCCGCGCACCTACGGCCCGCAGACGGCGAAGG
TGGTCGGCCCGCAGGGTGAGAGCATCTGGACGGATAAATATGGCCGCGTGAAGGTGAAGTTCCACTGGGA
CCGCCTCGGCAAGGGTGACGACACCAGCTCCAGCTGGGTGCGCGTCTCCAGCGCCTGGGCGGGCCAGGGC
TTCGGCGGGGTGCAGATACCGCGCGTGGGCGACGAAGTGGTGGTGGACTTCATCAACGGCGACCCGGACC
GTCCGCTGATAACGGGCCGCGTGTACAACGAAGCCAGCATGCCGCCGTGGGCGCTGCCGGCGGCGGCCAC
ACAGATGGGCTTTTTAAGCCGCTCGAAGGACGGCTCGCCGGATAACGCCAACGCCCTGCGCTTTGAGGAC
AAGGCGGGCGAGGAGCAGGTGTGGCTGCAGGCCGAGCGCAACCTTGATACCAAAGTGAAAAAAGATGAAA
CCCACAGCGTCGGCGGCTCGCGGATACTTTCTGTAAAGCAGGACTACACCGGCAAGGTTGAAGGCAAGCA
GGAACACGCCATTCAGATGAGCCGCAATGAGCTGGTCGGGGGGCAGTACGACATCAAGGGCCAGGGCACG
GTCACCGTTTCTTCCGCGACTGGTATTCGCCTGGTCACGGGCGATTCGGTGCTGGAAATGAGCGCGAACG
GCGAGGTCAATCTCTACTGTACAAAATTCGCGATCAACGCCAGCGGCACAGGGCAAATCAATACCGGCGG
CACGCTCGATCTGAACCTTAAGAATGAACCGGACAAAGCGTCAAACGTCGCGCCGACGCCTGGGGATATC
CAGAACGAAGTGGCAAAAACATTTAATTCCGACGGAGAGGGACAGGCATGA
 Primer design

Protein ID: 156936023
SecReT6 ID227
T6SS typei3
Gene symbol-
Locus tagESA_03917
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]3865273..3867420 [-]
Producthypothetical protein
NoteTssI
UniProt IDA7MQ29
KEGG IDesa:ESA_03917
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.20E-74, Aligned region: 25..330
Phage_GPD [PF05954], Evalue: 8.20E-74, Aligned region: 481..535
Phage_GPD [PF05954], Evalue: 8.20E-74, Aligned region: 556..600
Phage_base_V [PF04717], Evalue: 4.30E-24, Aligned region: 368..461
Gp5_C [PF06715], Evalue: 1.80E-16, Aligned region: 504..526
Gp5_C [PF06715], Evalue: 1.80E-16, Aligned region: 520..541
Gp5_C [PF06715], Evalue: 1.80E-16, Aligned region: 544..565
Gp5_C [PF06715], Evalue: 1.80E-16, Aligned region: 568..590
Gp5_C [PF06715], Evalue: 1.80E-16, Aligned region: 584..605
Protein Sequence: 715 a.a.     [Download]
>gi|156936023|ref|YP_001439939.1| hypothetical protein ESA_03917 [Cronobacter sakazakii ATCC BAA-894]
MKTMLNRITVQLPVEGLLFWKLSGREALSEPFMFTLTLLGTDARADRSALLGQPVTVTIPTQALMTPRYL
NGKVTRVAVSAVELSGTRYAAYELTVEPDLWPMQRDRNLRIFQGQTVPQIVKTLLGESRVNMEERLSGSY
RVWEYCVQYQESSLDFISRLLELEGIAYHFRHEQDRHTLVLTDAPGQYEPFPGYETIPYHVTPSGGSTDE
EGISQWALEDSVTPGIYSLDDYDFRKPNAWLFQARQNPLSPQPGSIDVYDWPGRFVEHGHGEFYARIRQE
RWQVEHRQTQGTATALGIAPGHTFVLRNAPFFGDNGEYLTTIAHYRFEENRYASGPDSNTLHEIRFEVIP
ADVPYRPAQKTPWPRTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLGKGDDTSSSWVRVSSAWAGQG
FGGVQIPRVGDEVVVDFINGDPDRPLITGRVYNEASMPPWALPAAATQMGFLSRSKDGSPDNANALRFED
KAGEEQVWLHAEKNMDTEIENDETHSVGSNRTKTIGANETTTVKKNRTETVVENETITVHQNRTETVDGN
ETITIHSNRTETVDQNEDVRIGQNQSVTVNGAQTLRVDKTKTETIALASMLNVGLAQNTNIGAAYVLNVG
AGWMTNVGAMQMHNVALKYSVNSGKDLSLSAGTTADFSAEDKITLVCGESMIVLEQNGTITLSANKIKMV
GEKVIDIDGTEININ
 
Nucleotide Sequence: 2148 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c3867420-3865273 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGAAGACTATGCTCAACCGAATCACCGTTCAGCTCCCGGTCGAGGGGCTGCTTTTCTGGAAACTCTCCG
GGCGCGAGGCGCTGTCGGAGCCGTTCATGTTCACCCTGACGCTGCTCGGCACCGACGCGCGCGCCGACCG
CAGCGCGCTGCTGGGGCAGCCGGTGACGGTGACCATCCCGACCCAGGCGCTGATGACGCCGCGCTACCTC
AACGGCAAGGTGACCCGGGTGGCGGTGAGCGCGGTGGAGCTTTCCGGCACCCGTTATGCCGCCTATGAGC
TGACGGTGGAGCCGGACCTGTGGCCGATGCAGCGCGACCGTAACCTGCGCATCTTCCAGGGCCAGACGGT
GCCGCAGATAGTGAAAACGCTGCTGGGCGAGAGCCGGGTGAACATGGAAGAGCGCCTTTCCGGCAGCTAC
CGCGTCTGGGAATACTGCGTGCAGTACCAGGAGAGCAGTCTGGACTTTATCAGCCGCCTGCTGGAGCTGG
AGGGCATCGCCTACCACTTCCGCCACGAGCAGGACCGCCACACGCTGGTGCTGACGGACGCGCCGGGCCA
GTACGAGCCGTTCCCCGGCTACGAGACCATTCCGTATCACGTCACGCCGTCCGGCGGTTCAACCGACGAA
GAGGGCATCAGCCAGTGGGCGCTGGAGGACAGCGTGACGCCGGGCATCTACAGCCTCGACGACTACGACT
TCCGCAAGCCCAACGCCTGGCTGTTCCAGGCGCGGCAGAACCCGCTGTCGCCGCAGCCGGGGAGCATTGA
TGTTTACGACTGGCCGGGCCGCTTTGTGGAGCACGGTCACGGGGAGTTCTATGCCCGCATCCGCCAGGAG
CGCTGGCAGGTGGAGCACCGCCAGACGCAGGGCACCGCGACGGCGCTCGGCATCGCGCCCGGCCACACCT
TTGTGCTGCGCAACGCCCCGTTCTTCGGCGATAACGGCGAGTACCTCACCACCATCGCGCATTACCGCTT
CGAGGAGAACCGCTACGCGAGCGGCCCGGACAGCAACACCCTGCATGAAATCCGCTTTGAGGTGATACCG
GCGGACGTGCCGTACCGCCCGGCGCAGAAGACGCCGTGGCCGCGCACCTACGGCCCGCAGACGGCGAAGG
TGGTCGGCCCGCAGGGCGAGAGCATCTGGACAGATAAATATGGCCGGGTGAAGGTGAAGTTCCACTGGGA
CCGGCTCGGCAAGGGCGACGACACCAGCTCCAGCTGGGTGCGCGTGTCGAGCGCCTGGGCGGGCCAGGGC
TTCGGCGGGGTGCAGATACCGCGCGTGGGCGACGAAGTGGTGGTGGACTTCATCAACGGCGACCCGGACC
GCCCGCTGATAACGGGTCGCGTGTACAACGAAGCCAGCATGCCACCGTGGGCGCTGCCTGCCGCGGCCAC
ACAGATGGGCTTTTTAAGCCGCTCGAAGGACGGCTCGCCGGATAATGCCAACGCCCTGCGCTTTGAGGAC
AAGGCGGGCGAGGAGCAGGTGTGGCTGCATGCTGAAAAGAACATGGATACCGAAATCGAGAACGACGAAA
CGCATTCGGTAGGCAGCAACCGCACCAAAACCATTGGCGCGAATGAAACCACGACGGTGAAGAAAAACCG
CACGGAAACGGTCGTGGAAAATGAAACGATCACGGTGCATCAGAACCGCACAGAGACGGTGGATGGCAAT
GAAACCATCACTATTCATTCCAACCGTACCGAGACGGTCGATCAGAACGAAGACGTGCGTATCGGGCAAA
ACCAGAGCGTGACCGTTAACGGTGCCCAGACGCTGCGCGTCGATAAGACCAAAACCGAAACCATCGCGCT
CGCCTCCATGCTGAACGTCGGTCTCGCGCAAAACACCAATATTGGCGCGGCATATGTGCTGAACGTCGGC
GCAGGCTGGATGACCAACGTCGGCGCGATGCAGATGCATAACGTGGCGCTTAAATATTCGGTGAACTCAG
GCAAAGATCTCAGTCTGTCTGCGGGCACGACAGCGGATTTCAGCGCGGAAGACAAAATCACGCTGGTCTG
CGGGGAATCGATGATTGTGCTGGAACAGAACGGCACCATTACGCTTAGCGCCAACAAGATCAAGATGGTC
GGCGAAAAGGTTATCGACATCGACGGTACGGAAATCAATATCAACTGA
 Primer design