SecReT6
Protein ID: 156936028
SecReT6 ID227
T6SS typei3
Gene symbol-
Locus tagESA_03922
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]3874161..3875204 [-]
Producthypothetical protein
NoteTssG
UniProt IDA7MQ34
KEGG IDesa:ESA_03922
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.10E-109, Aligned region: 27..331
Protein Sequence: 347 a.a.     [Download]
>gi|156936028|ref|YP_001439944.1| hypothetical protein ESA_03922 [Cronobacter sakazakii ATCC BAA-894]
MSETQPQPAPVKSASRLPENYWQQMMAAPWRYDLFQMLRRLDAQGGERYRLGRAPLPRFEPLRIGQQPSM
AFAPSTLAAVKPRDNTPLYDVSILSFGLFGPNGPLPMHLTEYARERLYHHQDDSLSAFADLFHHRLTLLF
YRAWADAQPTASLDRTDGPRIEKYLASLIGMGQPGQMEKGSLSHHARYSLVGHLTRNGRDAEGLEKILRH
YFHVPVTIVQNIPQWMPLTEREQARLGAGRRMPRLGEAAFLGVAVRDVQHKFRIELGPLDEETYQRFLPG
EPWVEELRDWVRQYMGIEYEWEVRVILRADAVKGVTPGGTGRLGYSAWLGKQPTPQPRGDLVFRAES
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c3875204-3874161 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGAGTGAGACGCAGCCACAACCTGCGCCGGTAAAAAGCGCCTCCCGGCTGCCGGAGAATTACTGGCAAC
AGATGATGGCCGCGCCGTGGCGCTACGATCTGTTCCAGATGCTGCGCCGTCTCGACGCGCAGGGCGGCGA
ACGCTACCGTTTAGGCCGCGCGCCGCTGCCGCGCTTTGAGCCGCTGCGCATCGGCCAGCAGCCGTCGATG
GCCTTTGCGCCGTCAACGCTCGCCGCGGTGAAACCGCGCGACAACACGCCGCTGTACGATGTGTCGATTT
TAAGCTTCGGCCTGTTTGGCCCGAACGGCCCGCTGCCGATGCACCTGACCGAATATGCGCGCGAGCGTTT
GTATCACCACCAGGACGACAGCCTGAGCGCGTTCGCGGATCTGTTTCATCACCGCCTGACGCTGCTGTTC
TACCGCGCCTGGGCCGACGCCCAGCCGACCGCGTCGCTCGACCGCACTGACGGGCCGCGCATTGAAAAAT
ATCTCGCCTCGCTTATCGGCATGGGCCAGCCGGGGCAGATGGAAAAGGGCAGCCTCAGCCACCACGCGCG
CTATTCGCTGGTCGGCCATTTGACGCGCAACGGGCGCGACGCCGAAGGGCTTGAAAAAATTCTGCGCCAC
TATTTCCACGTGCCGGTGACGATTGTGCAGAACATCCCGCAGTGGATGCCGTTAACCGAGCGTGAGCAAG
CGCGTCTCGGCGCGGGCCGCCGGATGCCGCGTCTCGGCGAGGCGGCGTTCCTCGGCGTGGCGGTGCGTGA
CGTGCAGCATAAATTTCGCATTGAGCTTGGTCCGCTGGATGAAGAGACCTACCAGCGTTTTCTGCCCGGC
GAGCCGTGGGTCGAGGAGCTGCGCGACTGGGTGCGTCAGTATATGGGCATCGAGTATGAGTGGGAGGTGC
GCGTTATCCTGCGCGCCGACGCGGTAAAAGGCGTCACGCCTGGCGGCACGGGCCGCCTCGGCTACAGCGC
CTGGCTTGGCAAGCAGCCCACCCCGCAACCGCGCGGCGATCTGGTTTTTCGCGCGGAAAGTTAA
 Primer design