SecReT6
Protein ID: 156936029
SecReT6 ID227
T6SS typei3
Gene symbol-
Locus tagESA_03923
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]3875201..3877072 [-]
Producthypothetical protein
NoteTssF
UniProt IDA7MQ35
KEGG IDesa:ESA_03923
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.30E-208, Aligned region: 5..623
Protein Sequence: 623 a.a.     [Download]
>gi|156936029|ref|YP_001439945.1| hypothetical protein ESA_03923 [Cronobacter sakazakii ATCC BAA-894]
MDSKLLEYYNRELAYLREMGAEFAERYPKVAGRLGMRGIEVADPYIERLMEGFAFLTSRVQLKMDAEFPR
FSQRLLEMLAPNYLAPTPSMAIAELHPDSAKGDLSNGFVVPRGTMMDSQLLKKNGVTCSYATAHDVRLLP
LHISQVELGGVPADAPLSQLGLSQRGAVSALRVRIACDGPVLLNHLDFDRLDFFLSGPDIQALQLLELLM
EHRVGIFCQTVGPKPSRVVLADDALRQEGFEADQALLPDDLRNFDGYRLLQEYFAFPARFQFLSLRGIGK
LLAQSGQANAFDIIILLDKTDTPLERVVDKSHLAMHCTPVINLFPKIAERQKLTEGLSEYHLVVDNIRPL
DYEIFSVSKIYASEDGQRDDQIFRPFWSTWSRDGGNYGAYFSLRREHRALSEHALRYGTRTGYVGSEAFV
SLVDASHAPWRDELRYITAEVMCTSRDLPLMLAQDMGQFVLPDSMPVRALTMRKGPTPPRPALAEGFSTW
RLISQLQMNYLSLMDAEDGEGAAALRQLLGLYARLAEAPVARQIDGIRHCVLEPVHRRVPEPGPIVFARG
VGISMTVDEQAFSGSSPWLLGSVLERVFARLVSMNSFTEFTLKSQQRGEVGYWGPRMGKRALI
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c3877072-3875201 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGGACAGTAAACTGCTCGAATATTACAACCGAGAGCTGGCGTATCTGCGCGAAATGGGCGCGGAGTTCG
CCGAACGCTACCCGAAAGTGGCGGGCAGGCTCGGTATGCGCGGGATTGAAGTCGCCGACCCGTACATCGA
GCGCCTGATGGAAGGCTTCGCCTTTCTCACCTCCCGCGTACAGCTCAAAATGGACGCCGAGTTTCCGCGC
TTCTCCCAGCGCCTGCTGGAGATGCTCGCGCCGAATTATCTGGCGCCCACGCCGTCAATGGCGATAGCCG
AACTGCACCCGGACAGCGCCAAAGGGGATCTGAGCAACGGGTTTGTGGTGCCGCGCGGCACGATGATGGA
CAGCCAGCTTCTGAAAAAGAACGGCGTCACCTGTAGCTACGCCACCGCCCATGACGTGCGCCTGCTGCCG
CTGCATATCAGCCAGGTGGAGTTAGGCGGCGTGCCGGCCGATGCGCCGTTAAGCCAGCTCGGTTTAAGCC
AGCGCGGCGCGGTCAGCGCCCTGCGCGTGCGCATCGCGTGCGACGGCCCGGTGCTGCTCAACCATCTCGA
TTTCGACCGCCTCGACTTCTTCCTGAGCGGGCCGGATATCCAGGCGCTGCAACTGCTGGAATTGCTGATG
GAGCACCGCGTCGGCATCTTCTGCCAGACTGTCGGCCCGAAACCCTCTCGCGTGGTGCTCGCCGACGACG
CGCTGCGTCAGGAAGGCTTTGAGGCTGACCAGGCGCTGCTGCCGGACGATCTGCGCAATTTCGACGGCTA
CCGCCTGTTGCAGGAATATTTCGCGTTCCCGGCGCGCTTCCAGTTTTTAAGCCTGCGCGGTATCGGCAAG
CTGCTGGCGCAGAGCGGGCAGGCGAATGCGTTCGATATCATCATTCTGCTGGATAAAACCGACACGCCGC
TGGAGCGCGTGGTGGATAAAAGCCATCTCGCGATGCACTGCACGCCGGTCATCAATTTGTTCCCGAAAAT
CGCCGAGCGCCAGAAGCTCACCGAGGGCTTAAGCGAATATCACCTGGTAGTGGATAACATCCGCCCGCTC
GATTACGAGATTTTCTCGGTCAGTAAAATTTACGCCAGCGAAGATGGCCAGCGCGACGACCAGATCTTCC
GCCCGTTCTGGAGCACCTGGAGCCGCGACGGCGGCAACTACGGCGCGTATTTCTCGCTGCGCCGCGAACA
TCGCGCGCTCTCGGAACACGCGTTGCGCTACGGCACGCGTACCGGCTATGTCGGCTCCGAGGCGTTTGTA
TCGCTGGTGGACGCAAGCCACGCGCCGTGGCGCGACGAACTGCGCTATATCACCGCTGAAGTGATGTGCA
CCAGCCGCGATCTGCCGCTGATGCTGGCGCAGGATATGGGCCAGTTTGTGCTGCCGGATTCCATGCCGGT
GCGCGCGCTCACCATGCGTAAAGGGCCGACGCCGCCGCGCCCGGCGCTGGCCGAAGGCTTCAGCACCTGG
CGGCTTATCAGCCAGCTGCAAATGAACTACTTAAGCCTGATGGACGCCGAAGATGGCGAGGGCGCGGCGG
CGCTGCGCCAGCTACTCGGCCTCTATGCGCGCCTGGCGGAAGCGCCGGTAGCGCGCCAGATTGACGGCAT
TCGCCACTGCGTGCTGGAGCCGGTGCACCGCCGCGTGCCGGAGCCGGGCCCGATTGTGTTCGCCCGCGGC
GTCGGAATTTCGATGACCGTTGATGAGCAGGCGTTTTCCGGCTCCAGCCCGTGGCTGCTTGGCAGCGTGC
TGGAGCGCGTCTTTGCACGCCTGGTCTCTATGAACAGCTTCACCGAGTTCACGCTCAAGAGCCAGCAGCG
CGGCGAAGTGGGCTACTGGGGGCCGCGAATGGGTAAAAGGGCGCTGATATGA
 Primer design