SecReT6
Protein ID: 156936030
SecReT6 ID227
T6SS typei3
Gene symbol-
Locus tagESA_03924
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]3877075..3877647 [-]
Producthypothetical protein
NoteTssE
UniProt IDA7MQ36
KEGG IDesa:ESA_03924
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-18, Aligned region: 58..166
Protein Sequence: 190 a.a.     [Download]
>gi|156936030|ref|YP_001439946.1| hypothetical protein ESA_03924 [Cronobacter sakazakii ATCC BAA-894]
MNKPYQDDDSGDLLRHGYRSRRNATTVSARDKMQPSLLDRLTDNAPDKRQEPANSNLVSHSALRRQVLRD
LQWLFNTINNEAQQDLSRVDHVRRSVFNFGVAPLAGKRMSEIEWGDIQQRLTEAILHFEPRILPQGLQVR
CVCDTKSLDLHNVLSIEIKGRLWCVPWPLEFLFRTDVDLENGHFELKDAG
 
Nucleotide Sequence: 573 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c3877647-3877075 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGAATAAACCGTATCAGGATGACGACAGCGGCGATCTGCTGCGCCACGGCTATCGTTCGCGCCGCAACG
CCACGACGGTCAGCGCGCGCGACAAAATGCAGCCGTCGCTGCTGGACCGTCTGACCGATAACGCGCCGGA
CAAACGTCAGGAGCCGGCGAACAGCAATCTCGTCTCGCACAGCGCGCTGCGCCGCCAGGTGCTGCGCGAT
TTGCAGTGGCTGTTCAACACCATTAACAACGAAGCGCAGCAGGATCTGAGCCGGGTGGATCATGTGCGCC
GTTCGGTCTTTAACTTCGGCGTGGCGCCGCTCGCGGGCAAGCGAATGTCGGAAATTGAGTGGGGCGACAT
CCAGCAGCGGCTCACCGAGGCGATTCTGCACTTCGAGCCACGCATTCTGCCGCAGGGGTTGCAGGTGCGC
TGCGTCTGCGACACCAAATCGCTCGACCTGCACAACGTATTATCGATTGAGATTAAAGGCCGCCTGTGGT
GTGTGCCCTGGCCGCTTGAGTTTCTGTTCCGCACCGATGTGGATCTGGAAAACGGCCATTTTGAGCTTAA
AGACGCGGGGTAA
 Primer design