SecReT6
Protein ID: 156936031
SecReT6 ID227
T6SS typei3
Gene symbol-
Locus tagESA_03925
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]3877640..3878473 [-]
Producthypothetical protein
NoteTagJ
UniProt IDA7MQ20
KEGG IDesa:ESA_03925
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.60E-44, Aligned region: 146..268
Protein Sequence: 277 a.a.     [Download]
>gi|156936031|ref|YP_001439947.1| hypothetical protein ESA_03925 [Cronobacter sakazakii ATCC BAA-894]
MNTLYQQLAGASVSDALSRLEADIKAQPGNADRRAAFVQFLCLNANWTRALTQLKSWAALAPQAQPTVTL
LQQAIEGEQQRAEVLAGRARPRMPGEQWPWLDLLLKALTETDPARASELRSEALEQAEANPGELTLAVGD
APGEPVHFDWLMDGDARLGPVCELIVNGNYFWVPFSAIASIRFQAPASVTDLVWRHAMVQLVDGTEQVCQ
IPARYPLETGAEDRFLLARTTEWQPLDAEGIHYLGAGQKVWLSGEQEFALLTLDSLAFGLPDDASHE
 
Nucleotide Sequence: 834 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c3878473-3877640 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGAACACGCTGTATCAACAACTGGCTGGCGCGAGCGTCAGCGACGCGCTGAGCCGTCTTGAGGCCGATA
TCAAAGCCCAGCCGGGCAACGCCGATCGCCGCGCCGCGTTTGTGCAGTTTCTCTGCCTGAACGCCAACTG
GACCCGCGCGCTCACCCAGCTGAAAAGCTGGGCCGCGCTGGCACCGCAGGCGCAGCCGACCGTGACGCTG
CTGCAACAGGCCATCGAAGGCGAGCAGCAGCGCGCCGAAGTGCTGGCAGGCCGCGCGCGTCCGCGTATGC
CGGGCGAACAGTGGCCGTGGCTGGATCTGCTGCTAAAAGCGCTGACAGAAACCGACCCGGCGCGCGCCAG
CGAGCTTCGCAGCGAGGCGCTGGAACAGGCCGAAGCCAATCCGGGCGAACTGACGCTGGCGGTGGGCGAC
GCGCCTGGCGAGCCGGTGCATTTTGACTGGCTGATGGACGGCGACGCGCGTCTGGGGCCGGTGTGCGAGC
TTATCGTTAACGGCAACTACTTCTGGGTGCCGTTCAGCGCTATCGCGTCGATTCGTTTCCAGGCTCCGGC
GAGCGTCACCGATCTGGTGTGGCGTCACGCGATGGTGCAACTGGTGGACGGCACCGAACAGGTCTGCCAG
ATCCCGGCGCGCTACCCGCTGGAAACCGGTGCGGAAGACCGCTTCCTGCTGGCGCGCACCACCGAGTGGC
AGCCGCTGGACGCGGAAGGCATTCACTATCTCGGCGCGGGTCAGAAAGTCTGGCTGAGCGGCGAACAGGA
GTTCGCGCTACTGACGCTGGATAGCCTCGCTTTCGGGCTGCCGGACGACGCATCGCATGAATAA
 Primer design