SecReT6
Protein ID: 156936034
SecReT6 ID227
T6SS typei3
Gene symbol-
Locus tagESA_03928
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]3880313..3882244 [-]
Producthypothetical protein
NoteFha
UniProt IDA7MQ23
KEGG IDesa:ESA_03928
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 8.90E-08, Aligned region: 27..93
UreE_N [PF02814], Evalue: 0.0035, Aligned region: 29..49
UreE_N [PF02814], Evalue: 0.0035, Aligned region: 78..99
Protein Sequence: 643 a.a.     [Download]
>gi|156936034|ref|YP_001439950.1| hypothetical protein ESA_03928 [Cronobacter sakazakii ATCC BAA-894]
MRFTITTNKPGHQPPQSSCDFYPPGGTIGRGTDNNLVLPDNERTISRLQAIVHISADGECRITNRGNVTR
VVLNDIPLERGRQVELQDGDVLGIDDYRIQVSDLALNAQPVIAMAAPKPNVAPQQPQAPQPAKPQQPPKA
DAQDNAPTAVPTEIWDSLMQEFSISDSISQGQSQSARPKTPEAQPFNPFNAPKEADRNPEDPLAHFQSGG
NEPLFGNERVNPDSLFKDDTPFDKDSIFNDVTPTTLVPPSDNRQAAKPQAPHKENEEELDPLALFGGVGS
TPVQSRSDDPLGLMMGGAVPLTPPDELNAGAAPLTPPPTAKQDAEPVKPAISPEKPQPEKPQPEMTTSPL
APNADDSIDLASLAGSPLFPEEVPEEPVTRVEVQPTPPEVQDYAGITLPTPQAVARSTAQTPKGRLRIDP
VQSPTSQGGTPTASNGDVLNGELLEALLEGMGLGELQPTPQFDRDNMRQLGQMLSMFSQGTVALLSSRSI
LKRGVKADMTMVLDDANNPFKLLPSGKTVLMQMFGTRMPGFMPPKKSVRDALIDLQAHQLGMIAGIRAII
AAMLQSFNPEQLEEEAKRDGAISRLALPASRKAALWDYFVRHYSDTAGEIEDDFHTLFGEAFLHAYDMEV
NQYKDSQSGSEEE
 
Nucleotide Sequence: 1932 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c3882244-3880313 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGCGATTCACGATTACTACCAACAAGCCCGGCCACCAGCCTCCTCAGAGCAGCTGTGACTTCTACCCGC
CGGGCGGCACGATTGGCCGTGGTACGGATAACAATCTGGTACTGCCGGATAACGAAAGAACGATTTCCCG
CCTGCAGGCGATTGTCCATATCTCCGCGGACGGCGAGTGCCGCATCACTAACCGCGGCAACGTCACCCGC
GTGGTGCTGAACGATATTCCGCTCGAGCGCGGCCGGCAGGTGGAGTTACAGGACGGCGACGTGCTCGGCA
TTGACGATTACCGCATTCAGGTGAGCGATCTGGCGCTGAACGCGCAGCCGGTTATCGCGATGGCCGCGCC
GAAACCGAACGTTGCGCCGCAGCAGCCTCAGGCGCCGCAGCCTGCGAAACCGCAGCAGCCGCCGAAAGCC
GACGCGCAGGACAACGCGCCAACGGCGGTGCCGACCGAAATCTGGGACAGCCTGATGCAGGAGTTCTCTA
TCTCCGACAGCATCAGCCAGGGTCAGAGCCAGAGCGCGCGCCCGAAAACACCGGAAGCGCAGCCGTTTAA
CCCGTTCAACGCCCCGAAAGAGGCGGATCGCAACCCGGAAGATCCGCTGGCGCACTTCCAGAGCGGCGGC
AACGAGCCGCTGTTCGGCAATGAAAGGGTCAACCCGGACAGCCTGTTCAAAGATGACACGCCGTTCGATA
AAGACAGCATTTTCAACGATGTGACCCCGACCACGCTGGTGCCGCCGTCTGATAACCGTCAGGCCGCAAA
ACCGCAGGCACCGCATAAAGAGAATGAAGAAGAGCTCGATCCGCTGGCGCTGTTTGGCGGCGTGGGCTCC
ACGCCGGTACAGAGCCGCAGCGACGATCCGCTTGGCCTGATGATGGGGGGCGCTGTACCGCTGACGCCGC
CGGATGAGCTTAACGCAGGCGCTGCGCCATTAACGCCGCCGCCCACCGCGAAGCAGGACGCCGAGCCGGT
TAAACCAGCAATTTCACCCGAAAAACCGCAGCCCGAAAAACCGCAGCCGGAGATGACGACCTCGCCGCTC
GCGCCAAACGCGGACGACTCAATCGATCTGGCGTCGCTCGCCGGTTCGCCGCTGTTCCCGGAAGAAGTGC
CGGAAGAGCCGGTGACGCGCGTGGAAGTCCAGCCGACACCGCCGGAAGTGCAGGATTACGCCGGTATCAC
GCTGCCGACGCCGCAGGCGGTGGCGCGCAGCACCGCGCAGACGCCAAAAGGCCGCCTGCGCATCGACCCG
GTGCAGTCGCCGACCAGCCAGGGCGGCACGCCTACGGCGTCTAACGGCGACGTGCTGAACGGCGAGCTGC
TGGAAGCATTGCTGGAAGGTATGGGTCTTGGCGAGCTGCAACCGACGCCGCAGTTTGACCGCGACAATAT
GCGCCAGCTCGGCCAGATGCTCAGCATGTTCTCGCAGGGCACCGTGGCGCTGCTCTCCTCGCGCTCGATT
CTCAAGCGCGGCGTGAAAGCCGACATGACGATGGTGCTGGACGACGCCAACAACCCGTTCAAGCTGCTGC
CGTCGGGCAAAACGGTACTGATGCAAATGTTCGGCACCCGTATGCCGGGCTTTATGCCGCCGAAAAAATC
GGTGCGCGACGCGCTTATCGATCTCCAGGCGCACCAGCTTGGGATGATCGCCGGTATCCGCGCCATCATC
GCCGCTATGCTGCAATCTTTTAACCCGGAGCAGCTTGAAGAAGAGGCGAAGCGCGACGGCGCTATCTCGC
GTCTGGCGCTGCCGGCGAGCCGCAAAGCCGCGCTGTGGGATTACTTTGTGCGTCATTACAGCGATACCGC
GGGCGAGATCGAGGACGATTTCCATACTCTGTTTGGCGAAGCCTTCCTGCACGCTTATGACATGGAAGTG
AATCAGTACAAAGACTCACAAAGCGGATCGGAAGAAGAATGA
 Primer design