SecReT6
Protein ID: 156936047
SecReT6 ID227
T6SS typei3
Gene symbol-
Locus tagESA_03941
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]3886942..3888441 [-]
Producthypothetical protein
NoteTssC
UniProt IDA7MQ19
KEGG IDesa:ESA_03941
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.40E-197, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|156936047|ref|YP_001439962.1| hypothetical protein ESA_03941 [Cronobacter sakazakii ATCC BAA-894]
MSNPSQQQELQSQQAFSQDEFSALLSKEFRPKTDQARSAVENAVKTLAQQALENTVTFSNDTYRTIQNLI
AGIDEKLSQQVNQIIHHEEFQKLESAWRGLNYLVNNTETDEMLKIRFMSISKQELGRTLKRFKGVGWDQS
PIFKKIYEEEYGQFGGEPFGCLVGDYYFDHSPQDVELLSEMARIGAAAHCPFITGTAPSVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEETDGANHSNYNWAN
AAYAMAANINRSFKEYGWCTSIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLIHRKNSDFAAFIGAQSLQKPAEYHDPDATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVQVQEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKSNEA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c3888441-3886942 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGAGCAATCCTTCTCAACAGCAAGAGCTGCAGTCGCAGCAGGCGTTCAGCCAGGATGAATTCAGCGCGC
TGCTCAGCAAAGAGTTTCGCCCGAAAACCGACCAGGCGCGTTCCGCCGTCGAAAACGCGGTAAAAACCCT
GGCCCAGCAGGCGCTGGAAAACACCGTGACCTTCTCGAACGACACCTACCGCACCATTCAGAACCTGATT
GCCGGTATCGACGAGAAACTGTCCCAGCAGGTTAACCAGATTATTCACCACGAGGAGTTCCAGAAGCTGG
AAAGCGCCTGGCGTGGCCTGAACTATCTGGTCAACAACACGGAAACCGACGAGATGCTGAAAATCCGCTT
TATGAGCATCTCCAAGCAGGAACTGGGCCGCACCCTGAAACGCTTTAAGGGCGTGGGCTGGGACCAGAGC
CCTATCTTCAAAAAAATCTACGAAGAAGAGTATGGCCAGTTCGGTGGCGAGCCGTTTGGCTGCCTGGTGG
GCGACTACTACTTCGACCACAGCCCGCAGGATGTGGAGCTGCTGAGCGAAATGGCGCGCATTGGCGCGGC
GGCGCACTGCCCGTTCATCACCGGCACCGCGCCAAGCGTGATGCAGATGGAATCCTGGCAGGAGCTGGCG
AACCCGCGCGACCTGACCAAAATCTTCCAGAACACCGAGTACGCTGCCTGGCGCAGCCTGCGCGAATCGG
AAGATGCGCGCTATCTGGGCCTCGTCATGCCGCGCTTCCTGTCGCGTCTGCCTTACGGCATCCGCACCAA
CCCGGTGGACAGCTTCGACTTCGAAGAAGAAACCGACGGCGCGAACCACAGCAACTACAACTGGGCCAAC
GCGGCCTACGCGATGGCGGCCAACATCAACCGTTCCTTTAAAGAGTACGGCTGGTGCACCTCCATTCGCG
GCGTGGAATCGGGCGGCGCGGTAGAAAATCTGCCGTGTCACACCTTCCCGAGCGACGACGGCGGCGTGGA
TATGAAATGCCCGACCGAAATCGCCATCAGCGACCGTCGCGAAGCGGAACTGGCGAAAAACGGCTTTATG
CCGCTGATCCACCGCAAAAACTCCGACTTCGCCGCCTTTATCGGCGCGCAGTCACTGCAAAAACCGGCGG
AATACCACGATCCGGACGCCACCGCGAACGCCCGTCTGGCAGCCCGCCTGCCGTACCTGTTCGCCTGCTG
CCGTTTCGCGCACTACCTCAAGTGCATCGTTCGCGACAAGATCGGTTCTTTCCGCGAGCGCGACGAAATG
GAACGCTGGCTGAACGACTGGGTGATGAACTATGTGGACGGCGACCCGGCGAACTCCTCTCAGGAAACCA
AATCCCGTAAGCCGCTGGCGGCAGCCGAGGTGCAGGTTCAGGAGATCGAGGACAACCCGGGCTACTACGC
CGCCAAGTTCTTCCTGCGTCCGCACTACCAGCTGGAAGGCCTGACCGTTTCTCTGCGTCTGGTCTCCAAA
CTGCCGTCGCTGAAGAGCAACGAGGCGTAA
 Primer design