SecReT6
Protein ID: 156936048
SecReT6 ID227
T6SS typei3
Gene symbol-
Locus tagESA_03942
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]3888445..3888981 [-]
Producthypothetical protein
NoteTssB
UniProt IDA7MQ06
KEGG IDesa:ESA_03942
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.00E-60, Aligned region: 15..168
Protein Sequence: 178 a.a.     [Download]
>gi|156936048|ref|YP_001439964.1| hypothetical protein ESA_03942 [Cronobacter sakazakii ATCC BAA-894]
MENIMPMSNSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVFADLVGKPVDPQPAVDERKFLEID
IDNFDERMKALKPRVAFQVDNTLTGEGKLNIDLTFDSMDDFLPDAVARKVEPLNKLLEARTQLSNLLTYM
DGKNGAEELIAKVLQDPTLLKSLSQMPKDDDGTKGNEE
 
Nucleotide Sequence: 537 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c3888981-3888445 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGGAGAACATCATGCCAATGAGTAACAGTGGGCAGAAATTTATCGCCCGTAACCGCGCGCCGCGCGTGC
AGATCGAGTACGACGTGGAAATCTACGGTGCGGAACGCAAAATTCAGCTTCCGTTTGTAATGGGCGTGTT
TGCCGACCTGGTCGGGAAGCCGGTCGATCCGCAGCCTGCGGTGGACGAACGTAAATTCCTTGAAATTGAT
ATCGACAACTTCGACGAGCGTATGAAAGCGCTCAAGCCGCGCGTGGCGTTCCAGGTGGACAACACCCTGA
CCGGCGAAGGCAAACTGAACATCGATCTCACTTTCGACAGCATGGACGACTTCCTGCCGGACGCCGTCGC
GCGTAAGGTCGAGCCGCTGAACAAGCTGCTGGAAGCCCGTACTCAGCTCTCTAACCTGCTGACCTACATG
GACGGTAAAAACGGTGCCGAAGAGCTTATCGCGAAAGTGCTTCAGGACCCGACGCTGCTCAAATCGCTGA
GCCAGATGCCGAAAGATGACGATGGCACCAAAGGTAACGAGGAGTAA
 Primer design