SecReT6
Protein ID: 156936049
SecReT6 ID227
T6SS typei3
Gene symbol-
Locus tagESA_03943
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]3889045..3890067 [-]
Producthypothetical protein
NoteTssA
UniProt IDA7MQ07
KEGG IDesa:ESA_03943
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.30E-21, Aligned region: 52..111
Protein Sequence: 340 a.a.     [Download]
>gi|156936049|ref|YP_001439965.1| hypothetical protein ESA_03943 [Cronobacter sakazakii ATCC BAA-894]
MDIETLLTPVSPEQPCGDNLEYDADYQAMEQASQGKAEQQFGDTIIPAEPADWTKVEKLALSLLERTKDL
RVMLALTHAWTKRRGLPGYADGLLLIQEALTRYWEPLYPLLEEYGEKDPFYRINALAGLGDKSSLTSTLR
TATLLRSNGDEITLRDAQSLLDNSKSECPGYPGGRPRLVDELARGGLPGIEAIVQIHARLEAIRTILVSH
LGESGVPEMEQLQKLTSIVALACQSGETQAPQELQDPDVQAENAPAATTTSAPARVVETDWRNVQLQTRD
DAQLMLEKVKQYFARHEPSHPAPLMIERVQRLIEMNFMDLIRDLAPDSVHQVENIFGRRE
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c3890067-3889045 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGGATATTGAAACCCTTCTTACTCCGGTGAGCCCGGAGCAGCCGTGCGGCGACAACCTGGAGTACGACG
CCGATTACCAGGCAATGGAACAGGCAAGCCAGGGCAAGGCGGAACAGCAGTTCGGCGACACCATTATTCC
GGCAGAGCCGGCGGACTGGACTAAAGTTGAAAAGCTGGCCCTGTCGTTGCTTGAGCGCACCAAAGATCTG
CGCGTCATGCTGGCGCTGACCCACGCATGGACCAAACGCCGCGGCCTGCCGGGCTATGCCGACGGGCTGC
TGCTGATTCAGGAAGCGCTGACGCGCTACTGGGAGCCGCTTTATCCGCTGCTGGAAGAGTACGGCGAAAA
AGATCCGTTCTACCGAATTAACGCGCTGGCGGGGCTTGGTGATAAATCCTCCCTGACCAGCACGCTGCGC
ACCGCGACGCTGCTGCGCAGCAACGGCGACGAAATTACGCTGCGCGACGCGCAGTCGTTGCTCGACAACA
GCAAAAGCGAATGTCCGGGTTATCCGGGCGGCCGCCCGCGGCTGGTGGATGAACTCGCGCGCGGCGGCCT
GCCGGGCATCGAGGCGATAGTCCAGATCCACGCGCGACTGGAAGCGATTCGCACCATTCTCGTCAGCCAT
CTCGGTGAGAGCGGCGTGCCGGAGATGGAGCAGCTCCAGAAGCTGACGAGCATTGTGGCGCTGGCCTGCC
AGAGCGGCGAAACCCAGGCGCCGCAGGAGTTACAAGACCCGGACGTGCAGGCGGAGAATGCGCCTGCCGC
CACGACGACCAGCGCCCCGGCGCGGGTAGTTGAAACCGACTGGCGCAACGTGCAACTGCAAACGCGCGAC
GACGCCCAGTTAATGCTTGAGAAAGTGAAGCAATATTTTGCCCGGCACGAGCCGAGCCACCCCGCGCCGC
TGATGATTGAGCGCGTGCAGCGACTGATTGAAATGAATTTCATGGATCTTATTCGCGACCTGGCGCCCGA
CAGTGTGCATCAGGTGGAAAACATTTTCGGACGCCGCGAGTAA
 Primer design