SecReT6
Protein ID: 156936051
SecReT6 ID227
T6SS typei3
Gene symbol-
Locus tagESA_03945
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]3890804..3894424 [-]
Producthypothetical protein
NoteTssM
UniProt IDA7MQ09
KEGG IDesa:ESA_03945
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.10E-101, Aligned region: 207..484
ImcF-related_N [PF14331], Evalue: 1.10E-101, Aligned region: 764..815
IcmF-related [PF06761], Evalue: 1.20E-87, Aligned region: 533..836
DUF1215 [PF06744], Evalue: 6.60E-32, Aligned region: 947..1072
AAA_16 [PF13191], Evalue: 0.0006, Aligned region: 142..270
AAA_16 [PF13191], Evalue: 0.0006, Aligned region: 839..884
Protein Sequence: 1206 a.a.     [Download]
>gi|156936051|ref|YP_001439967.1| hypothetical protein ESA_03945 [Cronobacter sakazakii ATCC BAA-894]
MLNILLSIVTNRILWGFMGVTALSAVVWMIGPLLSIVDSRPLESETNRIISIALIYLIWVHSHIVPRLYN
AWLNRKLMDKLNEGKPAEEGGSDVKRLGNDDKVLADRFDEAAQILKKAHFNAPGQRGQWTQRFSTQYLYQ
LPWYVIIGAPGSGKTTALVNSGLQFPLADRFGKTALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESEQA
QDAGEWLSFVDLLRKYRRRQPINGVIITISVSDLLTQSPEATQQQAVNLRQRLAELHEQLGIRFPVYVLV
TKADLLKGFRSYFGRFDKAQREQIWGFTFPWDRSKQADFDLLGAFTQEFALLQQRLDAGLPDTLLAESDP
KARAECYLFPQEFAALRPLLADYLSTVFARSNFETEFSPRGIYLASGTQEGLPFDRVMGELNRALSLPSG
GKEGDNWDSVSKEAPIPGGKGQSFFIKNLLQNVIFQEAGIAGQNRWWELRNRAVLWSGYAALIALLVVLG
GLWLTSYGNNKDYLAEVNDKVPGVERQSKALQTTAGRDLFSMLPFFNSLVDLPKSKEFDLNSPPVTYRMG
LYRGDDVNDASQALYQKALQEMLMPAVAQLITGWVRNDNGSDVEYSYEALKAYQMLYQPKHYDGKFLHSW
VMLNLERNLPQNVTQAQLNQLEWHLTQLLEPQIQTSPYAKDESLISRQQAMINQKPLSLRVYGRLKRLLE
RDENLKAVSLATLGGPQSELVFSRKSGKPVSDGVPGLYTPKGYWESFNGQIDTVTASLHDDDTWVLGLTT
AQEDKTQTDNAVRQLYMRDFISQWDSYLADIQLNNSADLNQRINTARVLSSSNSPLRRLVMNLSQVLTLS
RAEPQAGEGEAKEQGNRATRTLEALFSDRESGATTAAAAPQTPEQVVTDHYAPIIELAQPLEKGGKTIVF
DDFIKQIDELYRYLTAVQDAANSGMPPPGGEAISRLQASAGRLPGGLQNMFSRMAVGASSDTQQRELENV
RKRISVEVGSFCRQAIAGRYPLVRSASSEVTPDDLARMFAPGTGLMDSFFRDNLTNKVDTTQQRWRFTPG
IDGKTLPGSEGVLRPFQQAQYIRDAFFANGATTPSYRVTVRTVRMDNDILTLSLDVDGQLLRYSHGPQAV
QLMSWPGSGGTNQVRMQLGLANGTTSTLVTNGAWALNRFFDRARIAPGAGSLSRQATFSVDGHSVTLEFT
PNSIRNPFQLPGFACP
 
Nucleotide Sequence: 3621 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c3894424-3890804 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGCTGAATATTCTCCTTTCAATAGTGACCAACCGCATCTTGTGGGGGTTCATGGGCGTTACCGCGCTGT
CGGCGGTCGTCTGGATGATCGGGCCCTTGCTGTCCATCGTCGACAGCCGCCCGCTGGAGTCGGAAACCAA
CCGTATCATCAGCATTGCGCTTATCTACCTGATTTGGGTTCATAGCCACATCGTGCCGCGGCTCTACAAC
GCCTGGCTGAACCGCAAGCTGATGGACAAACTCAACGAAGGCAAGCCTGCGGAAGAGGGCGGGAGCGACG
TTAAGCGCCTCGGCAATGACGATAAAGTGCTGGCGGACCGCTTTGACGAAGCCGCGCAGATCCTTAAAAA
AGCGCACTTCAACGCGCCGGGCCAGCGCGGCCAGTGGACGCAGCGCTTCAGCACGCAGTATCTCTATCAG
CTTCCGTGGTATGTGATTATCGGCGCGCCGGGTTCCGGTAAGACGACGGCGCTGGTCAACTCCGGCCTGC
AATTCCCGCTCGCCGATCGCTTTGGTAAAACGGCGCTGCGCGGCATTGGCGGCACCCGCAACTGCGACTG
GTGGTTCACCAACGAAGCGGTGCTGCTCGATACCGCAGGCCGTTACACCACGCAGGAGAGCGAACAGGCG
CAGGACGCCGGTGAATGGCTAAGCTTTGTCGATCTGCTGCGTAAATACCGCCGCCGCCAGCCGATTAACG
GCGTCATTATCACCATCAGCGTTTCTGATCTGCTGACCCAGTCGCCGGAAGCGACGCAACAGCAGGCCGT
CAACCTGCGCCAGCGTCTGGCGGAGCTGCATGAGCAGCTCGGTATCCGCTTCCCGGTTTATGTGCTGGTG
ACCAAAGCGGACCTGCTGAAAGGCTTTCGTTCTTACTTTGGTCGCTTTGATAAAGCGCAGCGCGAACAGA
TCTGGGGCTTCACCTTCCCATGGGATCGCTCAAAACAGGCCGATTTTGACCTCCTGGGCGCGTTCACCCA
GGAGTTCGCGCTGCTTCAGCAGCGTCTCGACGCCGGCCTGCCGGATACGCTGCTTGCCGAAAGCGACCCG
AAAGCGCGCGCCGAGTGTTATCTGTTCCCGCAGGAGTTCGCGGCGCTGCGTCCGCTGCTCGCGGATTACC
TCAGCACCGTTTTCGCCCGTTCCAACTTTGAAACCGAATTCTCGCCGCGCGGGATTTATCTCGCGAGCGG
CACCCAGGAAGGGCTGCCGTTTGACCGCGTGATGGGCGAACTCAACCGCGCGCTGTCGCTGCCGTCCGGC
GGCAAAGAGGGCGACAACTGGGATTCGGTGAGCAAAGAAGCGCCGATCCCCGGCGGTAAAGGGCAAAGCT
TCTTTATTAAAAACCTGCTGCAAAACGTGATTTTCCAGGAAGCGGGCATCGCCGGGCAGAACCGCTGGTG
GGAGCTGCGCAACCGCGCGGTGCTGTGGTCTGGCTATGCGGCGTTGATAGCGCTCTTAGTGGTGCTGGGC
GGTCTGTGGCTCACCAGCTATGGCAACAACAAAGACTATCTGGCGGAAGTGAACGATAAAGTGCCGGGCG
TCGAGCGCCAGAGTAAAGCGCTGCAAACCACCGCCGGGCGCGATCTCTTCAGCATGCTGCCGTTCTTTAA
CAGCCTGGTCGATCTGCCGAAGAGTAAAGAATTTGACCTGAACTCGCCGCCGGTGACGTACCGCATGGGG
CTTTATCGCGGCGATGACGTCAACGACGCTTCGCAGGCGCTCTACCAGAAAGCGCTGCAGGAGATGCTGA
TGCCTGCCGTGGCGCAGCTCATCACCGGCTGGGTGCGTAACGACAACGGCAGCGACGTGGAATACAGCTA
CGAAGCGCTGAAAGCGTACCAGATGCTCTACCAGCCGAAGCACTACGACGGCAAATTCCTGCACTCCTGG
GTAATGCTCAACCTTGAGCGCAACCTGCCGCAGAACGTCACCCAGGCACAGCTTAACCAGCTCGAATGGC
ATCTGACGCAACTGCTGGAGCCGCAGATCCAGACCTCGCCGTACGCCAAAGATGAGTCGCTGATCAGCCG
CCAGCAGGCGATGATCAACCAGAAACCGCTGTCGCTGCGCGTCTATGGCCGCCTCAAGCGGTTGCTGGAG
CGCGATGAAAACTTAAAAGCGGTGTCGCTCGCCACGCTGGGCGGCCCGCAGAGCGAGCTGGTGTTTTCGC
GTAAAAGCGGCAAGCCGGTGAGCGATGGCGTGCCGGGGCTCTACACCCCGAAAGGCTACTGGGAAAGTTT
CAACGGCCAGATTGATACGGTCACCGCCTCGCTGCATGACGACGACACCTGGGTGCTGGGCCTGACCACC
GCGCAGGAAGATAAAACGCAGACGGACAACGCGGTGCGCCAGCTCTATATGCGCGACTTTATCAGCCAGT
GGGACAGCTACCTGGCGGATATTCAGCTTAACAACAGCGCCGACCTGAACCAGCGCATCAACACGGCCCG
CGTGCTTTCCAGCAGCAACTCGCCGCTGCGCCGTCTGGTGATGAACTTAAGCCAGGTGCTGACGCTCTCC
CGCGCCGAGCCGCAGGCGGGCGAAGGGGAAGCGAAAGAGCAGGGCAACCGCGCGACCCGCACGCTGGAGG
CACTCTTCAGCGACCGCGAAAGCGGGGCGACTACCGCCGCCGCCGCGCCGCAAACGCCGGAACAAGTGGT
GACCGATCACTACGCGCCCATCATCGAACTGGCGCAGCCGCTGGAGAAAGGCGGCAAAACCATCGTGTTT
GATGACTTTATCAAGCAGATCGATGAGCTCTACCGCTACCTGACCGCCGTACAGGACGCCGCCAACAGCG
GTATGCCACCGCCGGGCGGCGAAGCCATCAGCCGTTTACAGGCGAGCGCCGGGCGTCTGCCGGGCGGGCT
GCAAAATATGTTCAGCCGCATGGCGGTAGGGGCGAGCAGCGACACCCAGCAGCGTGAACTGGAAAACGTC
CGCAAGCGTATCAGCGTGGAAGTCGGCAGCTTCTGCCGCCAGGCGATCGCGGGCCGTTACCCGCTGGTGC
GCTCCGCCAGCAGCGAAGTGACGCCGGACGATCTGGCGCGCATGTTCGCGCCGGGCACCGGTCTGATGGA
CAGCTTCTTTCGCGATAACCTGACGAATAAAGTCGATACCACCCAGCAGCGCTGGCGCTTTACGCCAGGC
ATCGACGGCAAAACGCTGCCGGGCAGCGAAGGGGTGCTGCGTCCGTTCCAGCAGGCGCAATACATTCGCG
ACGCGTTCTTCGCCAACGGCGCGACCACGCCGTCTTATCGCGTGACGGTGCGCACCGTGCGGATGGATAA
CGACATTCTGACGCTGTCGCTCGACGTTGACGGCCAGCTTCTGCGTTACAGCCACGGCCCGCAGGCGGTG
CAGCTGATGAGCTGGCCGGGCAGCGGCGGCACCAATCAGGTGCGTATGCAGCTCGGGCTTGCCAACGGCA
CCACCTCGACGCTGGTGACCAACGGCGCGTGGGCGCTGAACCGCTTTTTCGATCGCGCCCGCATTGCGCC
GGGTGCAGGAAGCCTGAGCCGCCAGGCGACGTTTTCGGTTGACGGACACAGCGTGACGCTGGAATTCACG
CCGAACAGTATCCGCAACCCATTCCAGCTCCCTGGCTTCGCATGCCCTTAA
 Primer design