SecReT6
Protein ID: 156936052
SecReT6 ID227
T6SS typei3
Gene symbol-
Locus tagESA_03946
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]3894426..3895661 [-]
Producthypothetical protein
NoteTssL
UniProt IDA7MQ10
KEGG IDesa:ESA_03946
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.60E-70, Aligned region: 19..224
DUF2077 [PF09850], Evalue: 2.60E-70, Aligned region: 363..388
OmpA [PF00691], Evalue: 1.50E-15, Aligned region: 289..387
Protein Sequence: 411 a.a.     [Download]
>gi|156936052|ref|YP_001439968.1| hypothetical protein ESA_03946 [Cronobacter sakazakii ATCC BAA-894]
MEPQATGSDAILSGASSNNPLVAAANPLLNAIPQIRHSVSHEDQAGLRQRLIDEIRRFEVRCQQAALPYE
VIVGARYCLCTALDEAAALTPWGSRGVWSGSGLLVTFHNETWGGEKFFQLLARLSQNPREHIFLLEMINY
CLLLGFEGRYRVMDNGRTQLETIKQRLWQMIRSVRGSYPPPLSPHPEDQPVLRKLWRPVVPLWACVALAG
FLACLFFIILNWRLGDNTSPVLAKIYQTPLPEVTVQQPAREVAPVLNLRGFLRPEIEAGLVAVRDEADRS
VVILKGDGLFASASTVVRGRYEPVIDRVAQAMNNVSGKILVVGYSDNVPIRSARFASNYELSLARAESVQ
KMLQAHLADPNRVKAQGRGEMDPIAPNNTPENRARNRRVEITLLVSPDNTLAELNGLPQGN
 
Nucleotide Sequence: 1236 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c3895661-3894426 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGGAACCACAAGCCACCGGCAGCGATGCCATTCTTTCCGGCGCCAGCAGTAATAATCCGCTGGTCGCGG
CGGCTAACCCGCTGCTTAACGCGATCCCGCAGATTCGTCATTCTGTATCGCATGAAGATCAGGCCGGGCT
GCGCCAGCGCCTAATCGACGAGATCCGCCGCTTTGAAGTGCGCTGCCAGCAGGCGGCGCTGCCTTACGAA
GTGATCGTCGGCGCGCGCTACTGCCTGTGTACGGCGCTTGATGAAGCGGCTGCGCTCACGCCGTGGGGCA
GCCGTGGCGTCTGGTCCGGCAGCGGCCTGCTCGTGACGTTCCACAATGAAACCTGGGGCGGCGAGAAATT
CTTCCAGCTTCTGGCGCGGCTGTCGCAAAACCCGCGCGAGCACATCTTTCTGCTGGAGATGATCAACTAC
TGCCTGCTGCTCGGCTTTGAAGGGCGCTATCGCGTCATGGATAACGGGCGCACGCAGCTTGAAACCATCA
AACAGCGCCTGTGGCAGATGATCCGCAGCGTGCGCGGCAGCTACCCGCCGCCGCTCTCGCCGCACCCGGA
AGATCAACCGGTGCTGCGTAAACTCTGGCGTCCGGTGGTGCCGCTGTGGGCCTGCGTGGCGCTGGCCGGT
TTCCTGGCGTGCCTGTTCTTTATCATTCTCAACTGGCGGCTTGGCGATAACACCAGCCCGGTGCTGGCGA
AGATTTACCAGACGCCGCTGCCGGAAGTCACCGTTCAGCAGCCTGCGCGTGAAGTGGCGCCGGTGCTTAA
CCTGCGCGGTTTCCTGCGTCCGGAAATTGAAGCGGGCCTGGTGGCGGTGCGCGACGAAGCCGACCGCAGC
GTAGTGATTCTGAAAGGCGACGGCCTGTTTGCTTCCGCCTCAACGGTCGTACGTGGCCGTTATGAACCGG
TTATCGACCGCGTGGCGCAGGCGATGAACAACGTCAGCGGCAAAATCCTCGTGGTGGGCTACAGCGACAA
CGTGCCTATCCGCAGCGCGCGTTTCGCCTCGAACTACGAGCTGTCGCTCGCGCGCGCCGAATCGGTACAG
AAAATGCTCCAGGCGCACCTCGCCGACCCGAACCGCGTTAAAGCGCAGGGCCGCGGCGAGATGGACCCTA
TCGCTCCGAACAATACGCCGGAAAACCGCGCCCGCAACCGCCGTGTCGAGATAACGCTGCTGGTGTCGCC
GGATAACACACTGGCCGAGCTGAACGGATTGCCGCAAGGAAACTAG
 Primer design