SecReT6
Protein ID: 156936053
SecReT6 ID227
T6SS typei3
Gene symbol-
Locus tagESA_03947
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]3895679..3897022 [-]
Producthypothetical protein
NoteTssK
UniProt IDA7MQ11
KEGG IDesa:ESA_03947
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.50E-143, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|156936053|ref|YP_001439969.1| hypothetical protein ESA_03947 [Cronobacter sakazakii ATCC BAA-894]
MNKAEKVVWTEGMFLRPHHFQRAESFLQHHIREWGSLQRPYLWGFLDLEFDEAMLRQGRVALSYASGLLP
DGTPFSFRDARHGPAPLAIPDNLTHERVVLALPARRAGREEVIFSEAADSLARYATFEEEVEDDNALSVG
AATVQFGRLRLKLMLESELTAEWTAIGVAQVIEKRNDNQVRLDTSYIPPMLNAINSGQLYSMLNDLHGLL
GQRSQQISQRLRQPGRFNTSEMVEFMLLSLINHHLGHVTHLKTLPLLHPETLWRDWLAFACELTTWTAQR
APETTLPVYDHDNLAGCFGKLTLMLRQGLSLVMEESAIQLPLTERSHGLNVATVPESNMVREFGFVLAVK
ANVPGEALQTHFPAQMKVAPVTKIRDLVQLQLPGMVLRAMPVAPPQIPWHAGYSYFELEKGGELWKEMEK
SGAFALHLAGEFPGLDMEFWAIRSTNE
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c3897022-3895679 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGAACAAAGCAGAAAAAGTGGTCTGGACCGAAGGGATGTTCCTGCGTCCGCACCACTTCCAGCGCGCGG
AAAGTTTTCTGCAACACCACATCCGCGAATGGGGTTCGTTGCAGCGTCCGTATCTCTGGGGATTTCTCGA
TCTGGAATTTGACGAGGCGATGCTGCGTCAGGGACGCGTGGCGCTGAGCTACGCCAGCGGCCTGCTGCCG
GACGGCACGCCGTTCTCTTTCCGCGACGCCCGCCACGGCCCGGCGCCGCTCGCCATTCCCGACAACCTCA
CGCACGAGCGCGTGGTGCTGGCGCTGCCCGCCCGCCGCGCCGGACGTGAAGAAGTGATTTTCAGCGAGGC
GGCCGATTCGCTCGCCCGCTACGCCACCTTTGAAGAAGAAGTGGAAGACGACAACGCGCTGTCGGTCGGC
GCGGCGACGGTACAGTTTGGCCGCCTGCGTCTCAAGCTGATGCTGGAGAGCGAACTGACCGCCGAGTGGA
CGGCCATTGGCGTCGCGCAGGTGATTGAAAAGCGCAACGACAACCAGGTGCGCCTCGATACCAGCTACAT
TCCGCCGATGCTTAACGCCATCAACAGCGGGCAACTCTACAGCATGCTCAACGATCTGCATGGTCTGCTC
GGTCAGCGCAGCCAGCAAATCAGCCAGCGTCTGCGCCAGCCGGGGCGGTTTAACACCTCGGAGATGGTGG
AGTTCATGCTGCTGTCGCTGATTAACCATCATCTCGGCCACGTCACGCATTTAAAAACGCTGCCGCTGCT
CCACCCGGAAACCCTGTGGCGTGACTGGCTGGCGTTCGCCTGCGAACTCACCACCTGGACGGCGCAGCGC
GCGCCGGAGACGACGCTGCCGGTCTATGACCACGACAACCTGGCGGGCTGCTTTGGCAAACTGACGCTGA
TGCTGCGCCAGGGTCTGTCGCTGGTAATGGAAGAGAGCGCCATTCAGCTGCCGCTCACCGAGCGTTCGCA
CGGGCTCAACGTCGCCACCGTGCCGGAAAGCAACATGGTGCGCGAGTTCGGTTTCGTGCTGGCGGTCAAA
GCCAACGTGCCGGGCGAGGCGCTGCAAACGCACTTCCCGGCGCAGATGAAAGTCGCGCCGGTCACCAAAA
TTCGCGATCTGGTGCAGCTGCAGTTGCCGGGTATGGTGCTGCGCGCCATGCCGGTTGCGCCGCCGCAGAT
CCCGTGGCATGCCGGCTACAGCTATTTCGAACTGGAAAAGGGCGGCGAACTCTGGAAAGAGATGGAGAAA
TCCGGCGCGTTTGCGCTGCATCTCGCTGGTGAATTCCCGGGCCTTGATATGGAGTTTTGGGCCATTCGCA
GTACGAATGAATAA
 Primer design