SecReT6
Protein ID: 156936054
SecReT6 ID227
T6SS typei3
Gene symbol-
Locus tagESA_03948
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]3897047..3897553 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA7MPZ5
KEGG IDesa:ESA_03948
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.00E-32, Aligned region: 20..159
Protein Sequence: 168 a.a.     [Download]
>gi|156936054|ref|YP_001439970.1| hypothetical protein ESA_03948 [Cronobacter sakazakii ATCC BAA-894]
MKNRTVLRQGFLAFLIAALTLLSGCLSSSRSVPSQYSLHFQAHPQINNSAPLKVRVLLLKSDADFMSADF
FSLQNNAQTVLGANLLNSDEFFLMPGQLNKTLSGQSSLDARYIGVMAEYQALDGKKWRISLPLPAPSDSS
IYKFWKWSSDELEAKVFLDVNGIRVINE
 
Nucleotide Sequence: 507 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c3897553-3897047 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGAAAAACCGTACCGTTTTACGCCAGGGCTTCCTGGCGTTTTTGATTGCCGCTCTCACCTTACTGAGCG
GCTGTTTATCGTCTTCACGCAGCGTTCCTTCCCAGTACAGCCTGCATTTTCAGGCTCACCCGCAAATTAA
TAATTCCGCCCCGCTAAAAGTCCGGGTGCTGCTTTTGAAATCAGACGCCGACTTTATGTCTGCGGATTTC
TTTTCGCTGCAAAACAATGCTCAGACCGTGCTGGGAGCCAACCTGCTCAACAGCGACGAGTTCTTCCTGA
TGCCGGGCCAGCTGAACAAAACCCTCAGCGGCCAGAGCTCGCTTGACGCGCGCTACATCGGCGTGATGGC
GGAATATCAGGCGCTCGACGGCAAAAAATGGCGAATCTCGCTCCCGCTGCCCGCCCCCAGTGACTCCAGC
ATTTATAAATTCTGGAAATGGTCATCCGACGAACTTGAGGCAAAAGTGTTTCTTGACGTCAATGGGATCC
GCGTCATCAACGAATAA
 Primer design