SecReT6
Protein ID: 156977072
SecReT6 ID229
T6SS typei1
Gene symbol-
Locus tagVIBHAR_05857
StrainVibrio harveyi ATCC BAA-1116
Repliconchromosome II [GenBank: NC_009784] [Browse all T6SS(s) in this replicon]
Location [Strand]1042372..1045761 [+]
Producthypothetical protein
NoteTssM
UniProt IDA7N2A8
KEGG IDvha:VIBHAR_05857
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.20E-55, Aligned region: 153..411
IcmF-related [PF06761], Evalue: 8.30E-48, Aligned region: 205..231
IcmF-related [PF06761], Evalue: 8.30E-48, Aligned region: 494..755
DUF1215 [PF06744], Evalue: 2.80E-31, Aligned region: 866..987
Protein Sequence: 1129 a.a.     [Download]
>gi|156977072|ref|YP_001447978.1| hypothetical protein VIBHAR_05857 [Vibrio harveyi ATCC BAA-1116]
MFKQKILRNPILVSTIVALLLAAIFAAVYLFLLEDADKLYLWIGLGVISAFYLIFQLSLWFKKKNNSKAQ
RLETEEEALSMVIRPLLSHSGKKPIYLMIGNKGSGRRQFLFNSSAIKPMDRSRTAKNDFFEWYESDGAVY
VKPDQRLVFQEVSSSDASLWNTFVDEVIRHRPRKPFSGCLFFTDFEFMIVSEPEQKDYTITALLQRLSSI
SEKTSSALPVYLMMSKLDKLDGFKEYVHFSSLKTRVEFLSIPLKEAKGVITEYYRDGYRNLVKVLESNAL
DASANSTDIDEKQAILSFPKQFELCQAEISYVLERLCDVNSGTYSLDIREIFFCSSLQGGRKYNLLAKSC
SNYFNLPIIASEHTQLTETPYFSRFLIDSQILPESDFAGENKTYLRLIQRQSHLAMLASVILLAGGTYFF
VTTLDSNLRVINQLLGIDDNGQVEQEASFNQLLVNATRAIQPSYSAWLEGSRALDEEVLPLNISRLDQST
RLAYEALLKEVAQQLMPVVEKGYRLELTHNQHDVAATLPLLKGYLMLNDRSKRDIQFLRRQTLQTLNDLS
DKPDVVNQAMRYLDAYFRTQFAPVDINMDIVRATRRSLLANSNVDLVYAGILNQADAIDLGTLDLQRAVG
FEFNNVFNEPLDDNRLVIDKVYTSTGFSTFYRPRVDLMSQQVISDNWVLGLSNHVIPTKQEQDAFKTQVR
KKYTDDYINYWRNALSELRVQHYSNVGDLTNAIDLISGPSSPMTTVLKQVYANTQFSPVGEKNALIANVN
PKLAEVADTASEAVEEAVQPDYLLMKRVEQAFHLLNQLQVSETPNSPTPWDETIAALSRVRTYMKDIADA
PDPQMAALAAAQHRMNSTEADPLIKLKQIAQKSPEPVRNWLLDVVQQSWSVMIAESAKGIQTQWYSEIYT
KFKELGLGKYPFDLNATEEISIEDFELLFASGGLLDTFIQKNFAPFYDTNLWTPKQVDGETMPLSPALLV
QLRNYNVIRDTLINKSTNRVYIPFSAKVLDLDSSAIRATLKISDTDINYYHGPSRIREMEWPPQNGDFNI
SITIQDVTDEGKQHVLNKSGQWAIYRLLGDSTLTNTHNGSFVSDIKVSGRDLSLRITPLTQKNPFTLAEL
YNFTLPESI
 
Nucleotide Sequence: 3390 bp     [Download]
>gi|156975952|ref|NC_009784.1|:1042372-1045761 Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence
ATGTTCAAACAAAAAATACTAAGAAACCCGATTTTGGTTTCTACCATAGTGGCTTTGCTATTAGCCGCGA
TATTTGCAGCAGTGTATTTATTCTTACTTGAAGATGCAGATAAGCTATATCTATGGATTGGCCTTGGCGT
CATTTCTGCATTTTATCTTATATTCCAGTTGTCACTATGGTTTAAGAAAAAGAACAACTCGAAAGCCCAA
CGTTTGGAAACCGAGGAAGAAGCCCTTTCTATGGTTATCCGCCCTCTTCTTTCTCATTCAGGCAAGAAAC
CAATCTACCTAATGATTGGTAATAAGGGGTCTGGCCGACGTCAATTTTTGTTTAATTCAAGCGCAATTAA
ACCAATGGATCGTTCTCGCACTGCAAAAAACGATTTCTTTGAATGGTATGAATCTGACGGTGCGGTTTAT
GTAAAACCAGACCAACGCCTCGTATTCCAAGAAGTATCCAGTAGTGATGCTTCATTGTGGAACACGTTTG
TTGATGAGGTTATTCGTCACCGTCCAAGAAAACCGTTTTCTGGCTGTTTATTTTTTACTGACTTTGAGTT
CATGATCGTCTCAGAACCAGAGCAAAAAGATTACACCATTACCGCACTATTGCAGCGCCTAAGTTCTATT
AGCGAAAAAACATCATCGGCACTACCAGTTTATTTGATGATGTCTAAGCTTGATAAGTTGGACGGTTTCA
AAGAGTACGTACATTTCAGTTCTCTGAAAACTCGTGTGGAATTCCTTTCTATTCCTCTTAAAGAAGCGAA
AGGCGTCATCACTGAATACTACCGAGATGGTTACCGTAATCTGGTGAAAGTACTGGAAAGCAATGCTCTG
GACGCTTCTGCAAATTCGACAGACATCGATGAAAAACAAGCTATTCTGTCATTCCCGAAACAGTTCGAGC
TTTGCCAAGCAGAAATCAGTTACGTCCTTGAGCGTCTTTGCGATGTGAACAGCGGCACTTATTCGCTCGA
CATTCGTGAGATCTTTTTCTGCTCTAGCTTACAAGGTGGTCGTAAGTACAACCTGTTAGCAAAAAGCTGC
AGCAATTACTTTAATTTGCCGATCATTGCTTCAGAGCACACACAGCTGACAGAAACGCCTTACTTCTCTC
GCTTCCTGATTGACTCTCAGATTTTGCCTGAGAGCGATTTTGCGGGTGAAAACAAAACGTATTTACGCTT
AATCCAACGTCAAAGTCATTTGGCCATGTTAGCGTCCGTGATCTTGTTGGCTGGCGGTACCTACTTCTTT
GTTACCACACTAGACAGTAACTTGCGTGTGATTAACCAATTGCTTGGTATTGATGACAACGGTCAGGTTG
AACAAGAAGCAAGCTTCAATCAGCTTCTCGTAAACGCCACTCGCGCTATTCAACCTTCGTACAGTGCATG
GCTAGAAGGCTCTCGAGCTCTAGATGAAGAAGTGCTTCCACTGAACATTAGCCGCTTGGACCAAAGCACA
CGTCTGGCTTACGAAGCACTGCTTAAAGAAGTGGCACAACAGCTTATGCCCGTCGTTGAAAAAGGCTACC
GTCTAGAGTTGACGCATAACCAACATGACGTTGCCGCGACACTGCCATTGCTAAAAGGCTACTTGATGCT
GAACGATCGCTCAAAGCGTGACATTCAGTTCCTACGTCGCCAGACCTTGCAAACCCTTAATGATTTAAGC
GATAAGCCGGATGTAGTAAACCAGGCAATGCGCTATTTAGACGCTTATTTCCGTACTCAGTTTGCGCCTG
TTGATATCAATATGGACATTGTTCGTGCCACTCGCCGTTCTTTACTGGCGAACTCTAACGTCGACCTTGT
TTATGCGGGTATTTTGAATCAAGCCGATGCTATCGACCTTGGTACGCTAGATCTTCAACGCGCTGTTGGC
TTTGAGTTCAACAACGTGTTTAATGAACCGCTAGACGACAACCGCTTAGTGATTGACAAAGTCTACACGT
CTACTGGCTTTAGCACCTTCTATCGCCCTCGTGTGGACCTGATGTCACAGCAAGTTATCAGCGATAACTG
GGTTCTTGGCTTGTCTAATCACGTGATCCCTACGAAACAAGAGCAGGATGCGTTTAAGACACAGGTACGT
AAGAAATACACCGATGACTACATCAACTACTGGCGTAATGCACTGAGTGAACTGAGAGTACAGCATTACA
GCAATGTGGGCGACTTGACGAATGCAATCGACCTTATTTCTGGTCCGTCTTCTCCAATGACGACTGTATT
AAAACAAGTGTACGCGAACACCCAGTTTTCTCCGGTTGGTGAAAAGAATGCATTAATTGCCAATGTAAAC
CCTAAGCTAGCGGAAGTTGCAGATACGGCCTCAGAAGCAGTAGAAGAAGCCGTACAGCCAGATTACTTAC
TGATGAAGCGTGTTGAGCAAGCCTTCCACTTGTTAAACCAACTTCAAGTCAGTGAGACACCTAACTCCCC
GACTCCATGGGATGAAACCATTGCAGCATTAAGCCGTGTTCGTACTTACATGAAAGACATCGCTGATGCA
CCAGATCCACAAATGGCCGCACTTGCAGCAGCGCAACACCGCATGAACAGTACAGAAGCGGATCCGCTTA
TCAAACTGAAGCAGATCGCGCAGAAGTCTCCAGAGCCAGTGCGTAACTGGTTACTTGATGTGGTACAGCA
AAGCTGGTCAGTGATGATTGCTGAGTCCGCAAAAGGCATTCAAACCCAATGGTACAGCGAGATTTACACC
AAGTTTAAAGAGCTAGGGCTTGGTAAATACCCATTTGATCTGAACGCGACAGAAGAGATTTCAATTGAAG
ACTTCGAGCTGTTGTTCGCATCAGGTGGTTTGTTAGATACGTTTATTCAGAAGAACTTCGCACCGTTCTA
CGATACAAACTTGTGGACACCAAAGCAGGTGGATGGCGAGACAATGCCTCTTTCGCCTGCCCTATTGGTG
CAATTGCGCAATTACAACGTTATCCGCGATACGTTGATCAACAAGAGCACAAACCGAGTTTATATCCCGT
TCAGCGCGAAAGTATTAGACCTTGATTCCAGTGCTATCCGAGCCACTCTGAAAATTTCAGACACGGATAT
CAACTACTATCATGGTCCGAGCCGAATTCGTGAGATGGAGTGGCCGCCGCAGAACGGTGACTTCAACATT
AGTATCACGATCCAAGATGTGACAGACGAGGGCAAGCAGCACGTTCTTAATAAGAGTGGTCAGTGGGCGA
TATACAGATTGCTAGGTGATTCGACCCTGACAAACACTCATAACGGTAGCTTCGTCAGTGACATAAAAGT
GTCTGGAAGGGACTTAAGCCTTCGTATCACTCCTTTGACACAGAAAAACCCCTTCACTCTTGCTGAGCTG
TATAACTTTACACTCCCTGAGTCGATTTAA
 Primer design