SecReT6
Protein ID: 157159682
SecReT6 ID230
T6SS typei1
Gene symbol-
Locus tagEcHS_A0226
StrainEscherichia coli HS
Repliconchromosome [GenBank: NC_009800] [Browse all T6SS(s) in this replicon]
Location [Strand]241171..244695 [-]
Producthypothetical protein
NoteTssM
UniProt IDA7ZWG3
KEGG IDecx:EcHS_A0226
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.30E-84, Aligned region: 323..364
IcmF-related [PF06761], Evalue: 1.30E-84, Aligned region: 505..818
ImcF-related_N [PF14331], Evalue: 1.40E-62, Aligned region: 205..454
DUF1215 [PF06744], Evalue: 1.10E-33, Aligned region: 304..322
DUF1215 [PF06744], Evalue: 1.10E-33, Aligned region: 914..1033
AAA_22 [PF13401], Evalue: 0.00018, Aligned region: 140..273
AAA_22 [PF13401], Evalue: 0.00018, Aligned region: 856..887
AAA_16 [PF13191], Evalue: 0.0095, Aligned region: 136..155
AAA_16 [PF13191], Evalue: 0.0095, Aligned region: 246..257
AAA_16 [PF13191], Evalue: 0.0095, Aligned region: 841..909
Protein Sequence: 1174 a.a.     [Download]
>gi|157159682|ref|YP_001457000.1| hypothetical protein EcHS_A0226 [Escherichia coli HS]
MFRLPTPRLLSGLKSALRPAMPRFKVSAFWLLILAWIFLLVWIWWKGPTWTLYEEQWLKPLANRWLATAA
WGIIALMWLTVRVMKRLQQLEKMQKQQREEAVDPLSVELNAQQRYLDRWLLRLQRHLDNRRFLWQLPWYM
VIGPAGSGKTTLLREGFPSDIIYAPEGARGAEQRLYLTPHVGKQAVIFDIDGTLCAPADADILHRRLWEH
ALGWLKEKRARQPLNGIILTLDLPDLLTADKRRREHLLQALRSRLQDIRQHLHCQLPVYVVLTRLDLLQG
FAALFQSLNRQDRDAILGVTFTRRAHENDDWRTELNAFWQTWVDRMNLALPDLMVAQTHTRASLFSFSRQ
MQGSREPLVSLLEGLLDGENMNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPYF
TRSLFPQALLAEPNLATESRAWLIRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQSGITVLKQAKAFM
DVPPPQGEDDFGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRIGPYVEQTYLQLLEQRYLPSLF
NGLVKALNAAPPESEEKLAVLRVMRMLEDKSGRNNQVVKQYMAKRWSEKFHGQRDIQAQLMSHLDYALAH
TDWHAERQAGDGDAISRWTPYDKPVVSAQKELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQV
FTSADDNKLVVPQFLTRYGLQSYFVKQRDELVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISDY
TATWRAGMDNLNIRNFESIGQLTGALEQVISGDQPLQRALTVLRDNTQPGVFSEKLSAKEREEALAEPDY
QLLTRLGHEFAPENSTLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPI
FATRQMAKTLPAPLNRWVGRLTDQAWHVVMVEAVHYMEVDWRDSVVKPFNEQLANNYPFNPRSAQDASLD
AFERFFKPDGILDTFYQQNLKLFIDNDLSLEDGDNNVIIREDIIAQLETAQKIRDIFFSKQNGLGTSFAV
ETVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFR
LFGAGQLTGVQDGNFTVRFSVDGGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY
 
Nucleotide Sequence: 3525 bp     [Download]
>gi|157159467|ref|NC_009800.1|:c244695-241171 Escherichia coli HS, complete genome
GTGTTCAGATTACCAACACCCCGACTACTCAGCGGACTCAAATCAGCCCTGCGACCGGCGATGCCCCGGT
TTAAAGTCTCTGCTTTCTGGCTGCTGATACTGGCGTGGATTTTTCTGCTGGTGTGGATCTGGTGGAAAGG
CCCGACGTGGACGCTGTATGAAGAACAGTGGCTCAAACCACTGGCGAACCGCTGGCTGGCAACGGCGGCG
TGGGGGATTATTGCCCTGATGTGGCTTACCGTCCGGGTGATGAAGCGCCTGCAACAGCTTGAAAAAATGC
AAAAGCAACAGCGCGAGGAAGCCGTTGATCCGCTCAGCGTGGAACTGAACGCCCAGCAGCGTTATCTTGA
CCGCTGGCTGCTGCGCCTGCAACGCCATCTCGACAACCGCCGTTTCCTGTGGCAGTTGCCGTGGTATATG
GTCATCGGCCCGGCGGGCAGTGGCAAAACGACACTGCTGCGCGAGGGGTTTCCGTCCGACATTATTTATG
CCCCGGAGGGCGCACGCGGCGCAGAACAACGCCTGTACCTCACGCCCCATGTCGGTAAACAGGCGGTGAT
CTTTGATATCGACGGCACACTCTGCGCTCCCGCTGATGCGGATATCCTGCATCGCCGTCTGTGGGAACAT
GCCCTCGGCTGGCTGAAAGAAAAGCGCGCGCGCCAGCCGCTGAATGGGATTATTCTGACACTCGATTTAC
CCGATCTGCTTACCGCAGACAAACGCCGCCGCGAGCATCTGTTACAGGCGCTGCGCAGCCGCTTGCAGGA
TATACGCCAGCATCTTCACTGCCAGTTACCGGTTTACGTGGTACTTACCCGGCTTGATTTATTGCAGGGT
TTTGCCGCCCTGTTTCAGTCCCTGAACAGACAGGATCGCGATGCGATTCTGGGCGTCACGTTCACCCGCC
GTGCCCATGAAAATGATGACTGGCGAACAGAGTTGAATGCTTTCTGGCAGACATGGGTGGATCGAATGAA
TCTGGCGTTGCCGGATCTGATGGTCGCTCAGACTCACACCCGCGCGTCTTTATTCAGTTTTTCCCGCCAG
ATGCAGGGAAGCCGTGAACCGCTGGTGTCACTGCTTGAGGGTCTGCTTGATGGCGAAAATATGAACGTGA
TGCTGCGTGGTGTCTATCTCACCTCTTCGCTTCAGCGTGGACAGATGGATGATATATTCACCCAGTCTGC
CGCCCGCCAGTACCGGCTGGGCAATAACCCACTGGCGTCCTGGCCCCTGGTGGACACCGCGCCTTATTTC
ACCCGCAGCCTGTTCCCGCAGGCATTACTCGCAGAGCCTAATCTGGCAACAGAGAGCCGCGCCTGGCTGA
TACGTTCCCGTCGCCGCCTGACGGTTTTCTCTGCCACAGGCGGCGTGGCAGCACTGCTGCTCATCACCGG
CTGGCATCACTATTACAACGGTAACTATCAGTCTGGCATCACCGTGCTTAAGCAGGCCAAAGCCTTTATG
GACGTGCCGCCTCCGCAGGGGGAAGATGACTTTGGCAACCTGCAACTGCCGCTCCTGAACCCGGTACGCG
ATGCCACACTGGCCTATGGCGACTGGGGCGACCGCAGCCGTCTGGCCGATATGGGACTGTACCAGGGACG
ACGTATCGGGCCTTATGTGGAACAGACCTATCTGCAACTGCTGGAGCAACGTTACCTGCCCTCGCTGTTT
AACGGGCTGGTCAAAGCGCTGAACGCCGCGCCGCCGGAGAGTGAAGAAAAACTCGCGGTGCTGCGCGTGA
TGCGAATGCTGGAGGACAAAAGCGGACGTAACAATCAGGTGGTGAAGCAGTATATGGCAAAACGCTGGAG
CGAAAAGTTCCACGGTCAGCGCGATATCCAGGCACAACTGATGTCCCATCTTGACTACGCGCTGGCTCAT
ACTGACTGGCACGCAGAGCGTCAGGCGGGCGACGGTGACGCCATCAGCCGCTGGACGCCATATGACAAGC
CCGTGGTATCAGCACAGAAAGAACTGAGCAAACTGCCTGTCTACCAGCGGGTTTACCAGAGCCTGAAAAC
GCGGGCGCTGGGCGTTCTTCCTGCCGACCTCAATCTGCGTGACCAGGTAGGGCCAACCTTTGACCAGGTG
TTTACATCTGCCGATGACAACAAACTGGTTGTTCCACAGTTTCTTACCCGTTACGGCCTGCAAAGCTATT
TTGTAAAACAGCGCGATGAACTGGTTGAACTGACGGCGATGGATTCCTGGGTACTTAACCTTACCCGCAG
CGTGAAATACAGTGACGCCGACCGCGCGGAAATCCAGCGCCAGTTGACCGAGCAGTATATCAGCGACTAC
ACCGCCACCTGGCGGGCCGGGATGGACAATCTGAATATCCGCAATTTTGAGTCCATCGGACAACTGACCG
GGGCGCTGGAGCAGGTTATCAGCGGCGACCAGCCTTTGCAGCGGGCGCTGACCGTGCTGCGTGACAACAC
ACAGCCAGGCGTCTTTTCTGAAAAACTCTCTGCCAAAGAACGGGAGGAAGCCCTGGCAGAGCCGGATTAC
CAGTTACTCACCCGCCTCGGGCATGAATTCGCCCCGGAAAACAGTACCCTGGCAGTACAGAAAGACAAAG
AAAGCACGATGCAGGCCGTGTATCAGCAACTCACCGAGTTGCACCGCTACCTGCTGGCAATCCAGAACGC
GCCTGTACCAGGGAAATCGGCGCTGAAAGCCGTGCAGTTACGGCTTGATCAGAACAGCAGCGATCCGATA
TTCGCCACCCGCCAGATGGCAAAAACGCTGCCTGCTCCGCTCAACCGCTGGGTTGGCAGACTGACTGACC
AGGCCTGGCATGTGGTGATGGTGGAGGCTGTTCATTATATGGAAGTGGACTGGCGCGACAGCGTGGTGAA
ACCGTTTAACGAGCAACTGGCAAATAACTATCCGTTTAATCCGCGTTCTGCACAGGATGCCTCACTGGAT
GCCTTCGAACGCTTCTTTAAACCGGATGGCATACTGGATACCTTCTACCAGCAGAACCTGAAGCTGTTTA
TCGATAATGACCTGAGTCTGGAGGATGGCGATAACAACGTCATTATTCGCGAAGATATTATTGCGCAACT
GGAAACTGCGCAGAAAATCCGTGACATCTTCTTCAGCAAACAGAACGGTCTGGGAACATCCTTTGCCGTG
GAAACGGTATCGCTTTCAGGCAATAAACGCCGCAGTGTACTGAACCTTGACGGTCAGTTAGTCGATTACA
GCCAGGGCCGTAACTATACCGCCCATCTGGTCTGGCCTAACAACATGCGCGAAGGCAACGAAAGTAAGCT
GACGCTCATCGGCACCAGCGGCAACGCGCCGCGCAGTATCAGCTTCAGCGGGCCGTGGGCGCAGTTCCGC
CTGTTCGGGGCCGGACAACTGACCGGAGTACAGGATGGCAACTTTACCGTGCGCTTTAGCGTGGACGGTG
GCGCGATGACCTACCGTGTGCATACCGACACGGAAGATAACCCGTTCAGCGGTGGGTTGTTCAGCCAGTT
TGGTCTGTCAGACACACTGTACTGA
 Primer design