SecReT6
Protein ID: 157370040
SecReT6 ID233
T6SS typei2
Gene symbol-
Locus tagSpro_1798
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]1977765..1980968 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDA8GCR1
KEGG IDspe:Spro_1798
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.10E-70, Aligned region: 344..662
IcmF-related [PF06761], Evalue: 1.10E-70, Aligned region: 741..757
DUF1215 [PF06744], Evalue: 1.10E-35, Aligned region: 785..905
Protein Sequence: 1067 a.a.     [Download]
>gi|157370040|ref|YP_001478029.1| ImcF domain-containing protein [Serratia proteamaculans 568]
MGEASSRPVKKKITPRLPLKADISSHLRRRYNLFWRSKVRLLLVTGDENAIAQLVPNLQALQWLEGNRTV
LIYGGSLTSEPDEKKYTSLRKLRRGRPLDGIVRVIGEGQSITPQMSDSDLRGLEKISELLRYSAPVWLWQ
LCDSNWLQATRSEQAVGASFPQHANADDVTSQLELLLPALRAQGVSQVAENNSRDFLLRLGQHLKDGGIA
RWAQQLVPWLSASQQRVPLRGLMFSLPENKPTDTSEGTAGAAFADAEKYVPESQCHALTLPVTWQGIVED
CTRVRGRRVGMAWEQTLAWGIMAALGIWGTGLLLSFALNYSHISSVANKARSLVEHPSVSDSQLTALHDL
RNDAGRLQHHVQGGSPWYQRFGLDHNPQLLSAMLPWYGVANNRLIRDPANAALMQKLTALTNSAPNSDQR
AQLAKSGYDQLKAWLMMSRPDKVDGAFYAQTMQRVQPTRQGISTGLWQSLAPDLWAFSISGLLEQPQWKI
TLDTALVSQSRQVLLQQIGRRNAEGTLYENMLKSVRRNFADVSLEDMTSGTDARRLFSSDDVVPGMFTRQ
AWEGGIQQAIEKAANSRRDEIDWVLSDSRKTVSADLSPEALKARLTQRYFTDFAGSWLNFLNSLRLNPAH
NIADVTDQLTLMSDVRQSPMIALMNTLAWQGQAGELREGLSDSIIKSAKDLLGSEDKPVIDQRAAGPQGP
LDDTFGPLLTLMGKNQASNLMSADSTLSLQTYLTRITRVRLRLQQVASANDPQEMMQALAQTVFQGKSVD
LTDTQQYGSLVAASLGEEWSGFGNTLFVQPLTQAWETVLQPSAASLNARWSRSVVANWHTAFEGRFPFAA
SKSDASLPMLAEFIRKDTGRIDRFLTAELSGVLHKEGSRWVPNRTNSQGLTFNPAFLKALNQLSQLSDIL
FTDGSQGISFELQARPVPQVVETQLTIDGQQLHYFNQMADWQSFRWPGDTFKPGAMLTWTSTSAGTRLFG
DYSGTWGFIRWLEQGKRKQLDRSQWMMSFTAPDGRTLQWVLRSQLGKGPLALLALRGFRLPEQIFSVDAA
TAQALTGTENSAMEGME
 
Nucleotide Sequence: 3204 bp     [Download]
>ref|NC_009832.1|:1977765-1980968 ImcF domain-containing protein [Serratia proteamaculans 568]
ATGGGAGAGGCTTCTTCCAGACCGGTCAAAAAGAAAATAACGCCCCGGCTGCCGCTCAAGGCGGACATCA
GCAGCCATCTCCGTCGCCGCTATAACCTCTTCTGGCGAAGTAAAGTCCGCCTGCTGTTAGTCACAGGCGA
TGAAAACGCCATCGCTCAGTTGGTGCCCAACCTGCAAGCCCTTCAGTGGCTGGAAGGTAACCGCACGGTC
TTGATTTACGGCGGCAGCCTGACCTCTGAACCCGACGAAAAAAAATACACCTCCCTGCGCAAGCTGCGAC
GTGGTCGTCCTCTGGACGGCATCGTGCGCGTAATTGGCGAAGGCCAGAGTATTACGCCGCAGATGAGCGA
TAGTGATCTGCGCGGTCTGGAAAAAATCAGCGAACTGCTGCGCTATTCCGCCCCGGTTTGGCTGTGGCAA
CTGTGTGACAGCAACTGGTTGCAGGCGACGCGCTCTGAACAGGCGGTAGGGGCAAGCTTTCCGCAACACG
CTAATGCAGACGATGTTACCAGCCAGCTTGAGCTGCTGCTGCCGGCGCTACGGGCCCAGGGCGTGAGCCA
GGTCGCTGAGAACAACAGCCGCGACTTTCTGCTGCGCCTGGGCCAGCACCTTAAAGACGGCGGTATTGCC
CGTTGGGCTCAGCAACTGGTGCCATGGCTCTCTGCCTCCCAGCAGCGCGTTCCGCTGCGTGGCCTGATGT
TCAGCCTGCCGGAGAATAAACCCACTGATACGTCAGAGGGAACAGCCGGCGCTGCATTTGCCGACGCTGA
GAAATATGTTCCTGAATCACAATGTCATGCGCTGACCCTGCCGGTGACCTGGCAGGGTATTGTTGAAGAC
TGCACCCGTGTGCGTGGCCGCCGTGTCGGTATGGCCTGGGAGCAGACGCTGGCATGGGGCATTATGGCTG
CGCTCGGTATCTGGGGCACCGGGCTGCTGCTCTCTTTTGCCCTGAACTATAGTCATATTTCTTCTGTAGC
GAACAAAGCCCGTTCTCTGGTCGAGCATCCCTCTGTTTCTGACTCTCAACTGACGGCCCTGCATGACCTG
CGTAACGATGCCGGCCGCTTGCAACATCATGTTCAGGGCGGTTCACCCTGGTACCAGCGCTTTGGGCTTG
ACCATAACCCGCAACTGTTGAGTGCGATGCTCCCGTGGTATGGCGTGGCGAACAACCGCCTGATCCGCGA
CCCGGCCAATGCTGCCCTGATGCAGAAACTGACTGCGCTGACAAATTCGGCACCTAACAGCGACCAGCGC
GCACAGCTGGCGAAATCCGGTTATGACCAACTGAAAGCCTGGTTGATGATGTCCCGCCCGGACAAAGTGG
ATGGCGCGTTCTACGCCCAAACAATGCAAAGGGTGCAACCCACCCGGCAGGGGATTTCCACCGGATTGTG
GCAGAGCCTTGCGCCAGACTTGTGGGCGTTCTCTATATCTGGGTTGCTGGAACAGCCCCAGTGGAAAATC
ACCCTGGATACGGCGCTGGTCAGCCAGAGCCGCCAGGTGCTGTTGCAGCAGATTGGTCGCCGTAATGCGG
AGGGAACCCTCTACGAAAACATGCTCAAATCGGTGCGGCGTAACTTTGCCGATGTGTCACTGGAAGACAT
GACCAGTGGGACCGATGCCCGCCGTCTGTTCTCCAGCGATGACGTGGTGCCGGGGATGTTCACCCGTCAG
GCCTGGGAAGGGGGCATTCAGCAGGCCATCGAGAAAGCGGCAAACTCGCGCCGGGATGAAATTGACTGGG
TGTTGAGCGACAGTCGCAAGACCGTTTCTGCCGACCTTTCTCCGGAAGCGCTGAAAGCGCGTCTGACGCA
GCGTTATTTCACTGATTTTGCCGGCAGCTGGTTGAACTTCCTCAACAGCCTGCGGCTGAATCCGGCGCAC
AACATTGCGGATGTGACTGACCAACTGACATTGATGAGCGATGTGCGTCAGTCGCCGATGATTGCGCTGA
TGAATACGTTGGCCTGGCAGGGACAAGCCGGCGAGCTGCGCGAAGGGCTGTCGGATTCCATTATCAAGTC
GGCAAAAGATCTGCTCGGTAGTGAGGATAAGCCCGTTATCGATCAGCGTGCAGCCGGGCCGCAGGGACCG
CTGGATGACACTTTCGGGCCGCTGCTAACCCTGATGGGGAAAAACCAGGCCAGCAACCTAATGTCGGCCG
ACAGCACGCTGAGCCTGCAAACCTACCTCACTCGTATCACCCGTGTGCGTCTGCGCCTGCAACAGGTGGC
GAGTGCTAACGATCCGCAGGAGATGATGCAGGCCCTGGCACAGACCGTATTCCAGGGCAAAAGTGTGGAT
CTGACCGATACCCAGCAGTACGGCAGCCTGGTGGCGGCCAGTTTGGGTGAGGAATGGAGCGGTTTTGGCA
ACACCCTGTTTGTGCAGCCGCTGACGCAGGCCTGGGAAACCGTACTGCAACCGTCTGCAGCCAGCCTGAA
CGCCCGCTGGAGCCGTTCAGTGGTAGCAAACTGGCATACCGCCTTTGAGGGGCGCTTCCCGTTTGCCGCG
AGCAAAAGCGACGCTTCCCTGCCGATGCTGGCGGAGTTTATCCGCAAGGACACCGGGCGTATCGACCGTT
TCCTGACCGCTGAACTCAGCGGCGTGTTGCATAAAGAAGGCAGCAGGTGGGTGCCGAACCGTACTAACAG
CCAGGGGCTGACGTTTAACCCGGCATTTCTGAAAGCGTTAAATCAGCTGAGCCAGTTATCCGACATTCTG
TTTACCGACGGCAGTCAGGGCATCAGCTTCGAATTACAGGCCCGCCCGGTACCGCAGGTGGTGGAAACCC
AGCTAACGATTGACGGGCAGCAGTTGCATTACTTCAACCAGATGGCCGACTGGCAGTCCTTCCGCTGGCC
GGGGGATACCTTCAAGCCCGGCGCGATGCTGACCTGGACTTCAACCAGCGCCGGTACACGTCTGTTCGGG
GATTACAGTGGCACCTGGGGCTTCATTCGCTGGCTGGAGCAGGGCAAGCGGAAACAGCTTGATCGCAGCC
AGTGGATGATGAGTTTTACCGCTCCGGATGGTCGCACGCTGCAGTGGGTTCTGCGTTCCCAACTGGGCAA
AGGGCCGCTGGCGTTGCTGGCGTTACGCGGTTTCAGGCTTCCTGAGCAGATATTCAGCGTGGATGCCGCC
ACTGCACAGGCGCTGACCGGCACAGAGAATTCAGCCATGGAGGGGATGGAATAA
 Primer design