SecReT6
Protein ID: 157371240
SecReT6 ID234
T6SS typei3
Gene symbol-
Locus tagSpro_3000
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]3297690..3301328 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDA8GG61
KEGG IDspe:Spro_3000
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.80E-102, Aligned region: 207..488
IcmF-related [PF06761], Evalue: 4.70E-90, Aligned region: 535..842
IcmF-related [PF06761], Evalue: 4.70E-90, Aligned region: 877..909
DUF1215 [PF06744], Evalue: 2.00E-31, Aligned region: 953..1078
Protein Sequence: 1212 a.a.     [Download]
>gi|157371240|ref|YP_001479229.1| ImcF domain-containing protein [Serratia proteamaculans 568]
MLSTLFSIITSRLLWGFAGITALAFIIWMIGPLVAIGDYRPLEPALNRQLTIGAIYLIWFLCRIIPRIYS
AWFNRRLLSNLRAAEEVPAENGKPVAKQDEQLAQRFDEAAQLLKKARFAPGQGDSKHRWMTHFSSQYLYQ
LPWYVIIGAPGAGKTTALVNSGLHFPLADRFGKSALRGVGGTRNCDWWFTNDAVLLDTAGRYTTQESQRE
EDADEWKSFVGLLKKYRTRQPINGVMVTISIADLLSESSEARAAQASSLRKRLIELHEQLGIHFPVYVLV
TKTDLLNGFMAYFNGFDKAQREQIWGFTFPYEASRQPDFNLNATFEQQYALLQQRLDAALPETLLVEHDG
RQRAESYLFPQEFAALRPLLGQYLEQVFATSSFETRFTPRGIYFTSGTQEGLPFDRVMGELNRYLQLPTA
NSQPHANPAWNHVDPAAPIPAGKGQSFFLKDTLESVIFQESGLAGSNRWWEYRNRAVHWAGYILLAACLA
ILAIFWFTSYSNNKAYLAEVAAKVPGVERQGLGLTQLGNGDMLSLLPFLNSVLHLPDSQNFSLEDPPFTY
RMGLYRGDQVSDASDSLYQKALKELLLPQVAQQIATTLRNDNHGDADFSYEALKAYQMLYLPKQYDGKFL
RAWVMLNLQRNLPQGSTQKQLQQIEWHLSQLLDEQIQASPYAKDEPMVEQAQAALNRAPLSQRVYGRLKR
LLLKQTEIKPVSLVDLAGPQTELAFSRKSGKPVTDGVPGLYTSRGYWKTFNDNIDPVTDTLRQEDVWVLN
SKTPDQKNADLIKTIRQLYMQDFINAWDELLGDIQLANIGNLSQRISSARLLSGNPSPMRNLLVNVSKNV
TLRDEKSTADSRSLLDKTEDRLSQSANHQLEALFTHRPANADGDVSAQPEQLVMAHFAALLELAQSQGEG
NKAIPFDSVLKQVDELYSYLTAVQGAANSGMSAPPSDIIPRLQAESGRLPVPFKQMLLSLAIGASSDTQR
KEMENVKKRISVEVGSFCRQAIAGRYPLVARARQEVTPDDLARMFAPNSGLMDSFFRDNLQGKVDTTRAN
WRFTPGVDGKTLPGGEGILRSFQQAQRIRDAFFANGTATPSYRVTVRPVRMDNDILNLTLDIDGQLFKYS
HGPQVPLVISWPGTRNTNQVHLQLALANGSTASLVTSGPWALNRLVDMAQTSAGSSSLGRQATFNLDGHR
VTLEFTPNSIRNPFQLPAFSCP
 
Nucleotide Sequence: 3639 bp     [Download]
>ref|NC_009832.1|:3297690-3301328 ImcF domain-containing protein [Serratia proteamaculans 568]
ATGCTCAGTACGTTATTCTCCATCATCACCAGCCGCCTGTTATGGGGCTTTGCCGGCATTACTGCGCTGG
CGTTCATCATCTGGATGATCGGCCCGTTGGTGGCTATCGGCGATTATCGGCCGCTGGAGCCGGCACTCAA
CCGCCAGTTAACCATCGGCGCTATCTATCTGATCTGGTTCCTGTGCCGCATTATTCCACGCATCTACAGT
GCCTGGTTCAACCGCCGCCTGCTGAGTAACCTGCGTGCCGCCGAAGAAGTCCCGGCTGAAAACGGCAAGC
CGGTAGCCAAACAGGATGAGCAGTTGGCCCAGCGCTTTGATGAAGCGGCGCAATTGTTGAAGAAAGCCCG
CTTCGCACCGGGTCAGGGGGACAGCAAACACCGCTGGATGACCCACTTCAGCAGTCAATATCTCTACCAG
TTGCCGTGGTATGTGATCATCGGTGCGCCGGGTGCCGGTAAAACCACCGCGCTGGTCAACTCCGGCCTGC
ATTTTCCGCTGGCGGATCGCTTCGGCAAGTCTGCCCTGCGCGGTGTGGGCGGTACCCGTAACTGCGACTG
GTGGTTCACCAATGACGCCGTGCTGCTTGACACCGCGGGTCGTTATACCACTCAGGAAAGCCAGCGCGAG
GAAGACGCCGACGAGTGGAAAAGCTTCGTCGGCCTGCTGAAAAAATACCGTACCCGTCAGCCGATCAACG
GCGTGATGGTGACCATCAGCATCGCCGATCTGTTGAGCGAAAGTAGCGAAGCCCGCGCCGCGCAGGCCAG
CTCGCTGCGTAAACGCCTGATTGAGCTGCATGAACAGTTGGGGATCCATTTCCCGGTTTATGTGTTGGTC
ACCAAGACCGACCTGCTGAATGGCTTTATGGCCTATTTCAACGGCTTTGATAAAGCGCAGCGCGAGCAAA
TCTGGGGGTTCACCTTCCCCTATGAGGCATCGCGTCAGCCAGATTTCAATCTGAATGCCACCTTCGAACA
ACAGTATGCTTTGCTGCAGCAGCGACTGGATGCCGCGCTGCCTGAGACCTTGCTGGTTGAACATGATGGC
CGCCAGCGGGCTGAAAGCTACCTGTTCCCGCAGGAATTCGCGGCCCTGCGTCCGCTGCTGGGCCAGTATC
TGGAACAGGTGTTTGCCACCTCCAGTTTTGAAACCCGCTTCACCCCGCGCGGTATTTACTTCACCAGCGG
CACCCAGGAAGGACTGCCGTTCGATCGGGTAATGGGCGAACTGAACCGTTACCTGCAATTGCCAACGGCG
AACAGCCAACCACACGCCAACCCGGCCTGGAACCATGTGGATCCGGCCGCGCCCATCCCGGCTGGCAAGG
GGCAAAGCTTCTTCCTGAAAGACACGCTGGAATCGGTGATCTTCCAGGAGTCCGGGTTGGCGGGCAGCAA
CCGCTGGTGGGAATACCGTAACCGCGCTGTGCATTGGGCGGGCTATATCCTGCTGGCGGCCTGCCTGGCG
ATCCTGGCGATTTTCTGGTTCACCAGCTACAGCAACAACAAGGCTTATCTGGCTGAAGTGGCCGCCAAGG
TACCCGGCGTAGAACGCCAGGGGCTGGGTCTGACGCAGTTGGGCAATGGCGATATGCTTTCGCTGCTGCC
GTTCCTCAACAGCGTGCTGCATTTGCCGGACAGTCAGAACTTCTCGCTGGAAGATCCCCCGTTCACCTAT
CGCATGGGGCTGTACCGTGGCGATCAGGTCAGTGATGCCAGCGACTCGCTGTATCAGAAAGCGCTAAAGG
AGTTGCTGCTGCCACAGGTGGCACAGCAGATCGCCACGACGCTGCGCAACGACAACCACGGCGATGCCGA
TTTTAGCTACGAAGCGCTGAAGGCCTACCAGATGCTGTATCTGCCGAAACAGTATGACGGCAAATTCCTG
CGCGCCTGGGTCATGCTCAACCTGCAACGCAACCTGCCGCAGGGCAGCACCCAGAAGCAGCTGCAGCAGA
TTGAATGGCACCTGAGCCAATTGCTCGACGAACAGATCCAAGCTTCGCCTTACGCCAAAGATGAACCTAT
GGTGGAACAGGCCCAGGCCGCGCTAAACCGTGCTCCCCTGTCGCAGCGGGTGTACGGCCGCCTGAAACGC
CTGCTGCTTAAGCAAACCGAGATTAAACCGGTCAGCCTGGTTGACCTGGCCGGCCCGCAGACCGAACTGG
CCTTTTCGCGCAAAAGCGGCAAACCGGTGACCGACGGGGTGCCGGGCCTGTATACCTCACGGGGCTATTG
GAAAACCTTCAACGACAATATTGATCCGGTGACCGATACCCTGCGTCAGGAAGATGTTTGGGTACTGAAC
AGCAAAACCCCGGATCAGAAAAACGCCGATTTGATCAAAACCATTCGCCAACTGTACATGCAGGACTTTA
TCAACGCCTGGGATGAACTGCTGGGTGATATTCAGTTGGCAAATATCGGAAACCTGAGTCAGCGCATCAG
CAGCGCACGCTTGTTGTCAGGCAACCCTTCGCCGATGCGTAACCTGCTGGTTAACGTCAGCAAAAATGTC
ACCCTGCGCGACGAGAAAAGCACTGCTGACTCCCGTTCGCTGCTGGATAAAACCGAAGACCGGCTGAGCC
AGAGTGCCAACCACCAATTGGAAGCCCTGTTCACCCATCGACCGGCCAACGCCGACGGCGATGTCTCAGC
CCAGCCGGAACAACTGGTGATGGCGCATTTCGCCGCATTACTGGAGCTGGCGCAAAGTCAGGGAGAAGGC
AACAAGGCGATCCCGTTCGACAGCGTGCTGAAACAGGTTGATGAGTTGTACAGCTACCTGACCGCGGTTC
AGGGTGCGGCCAACAGCGGCATGTCGGCACCGCCCAGCGATATCATCCCGCGCTTGCAGGCCGAGTCCGG
TCGTTTACCGGTGCCGTTCAAACAGATGCTGCTGTCGCTGGCGATTGGTGCCAGCAGCGACACGCAACGC
AAAGAGATGGAAAACGTCAAGAAACGCATCAGCGTCGAAGTCGGCAGCTTCTGCCGCCAGGCGATTGCCG
GGCGTTATCCTCTGGTCGCCCGGGCGCGTCAGGAAGTGACGCCAGACGATTTGGCGCGCATGTTTGCGCC
GAACAGCGGGCTGATGGACAGCTTCTTCCGTGACAATTTGCAGGGCAAGGTCGACACCACCCGTGCCAAC
TGGCGTTTCACTCCCGGCGTAGACGGCAAAACGCTGCCCGGTGGCGAAGGCATCCTGCGTTCATTTCAGC
AGGCGCAACGCATTCGTGACGCCTTCTTCGCCAACGGTACCGCCACGCCGTCTTACCGGGTGACCGTACG
ACCGGTACGGATGGATAACGACATCCTCAACCTGACGCTGGATATCGACGGGCAACTGTTCAAATACAGC
CACGGGCCGCAGGTTCCTCTGGTGATCAGTTGGCCGGGTACCCGCAATACCAATCAGGTGCACCTGCAGC
TGGCACTGGCCAACGGCTCCACCGCCAGCCTGGTCACCAGCGGCCCCTGGGCGCTGAACCGTTTGGTGGA
TATGGCGCAGACTTCCGCCGGCAGCAGCAGCCTCGGTCGTCAGGCAACCTTTAACCTGGATGGCCACCGC
GTAACGCTGGAGTTCACTCCCAACAGTATCCGCAATCCGTTCCAGTTACCGGCATTCTCCTGCCCGTAG
 Primer design