SecReT6
Protein ID: 15799899
SecReT6 ID6
T6SS typei1
Gene symbol-
Locus tagZ0250
StrainEscherichia coli O157:H7 str. EDL933
Repliconchromosome [GenBank: NC_002655] [Browse all T6SS(s) in this replicon]
Location [Strand]245399..248833 [-]
Productmacrophage toxin
NoteTssM
UniProt IDQ8X7W9
KEGG IDece:Z0250
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.40E-85, Aligned region: 293..334
IcmF-related [PF06761], Evalue: 5.40E-85, Aligned region: 475..788
ImcF-related_N [PF14331], Evalue: 2.40E-62, Aligned region: 175..425
DUF1215 [PF06744], Evalue: 1.00E-33, Aligned region: 274..292
DUF1215 [PF06744], Evalue: 1.00E-33, Aligned region: 884..1003
AAA_22 [PF13401], Evalue: 0.00013, Aligned region: 110..243
AAA_22 [PF13401], Evalue: 0.00013, Aligned region: 826..857
Protein Sequence: 1144 a.a.     [Download]
>gi|15799899|ref|NP_285911.1| unnamed protein product [Escherichia coli O157:H7 str. EDL933]
MLILAWIFLLVWIWWKGPTWTLYEEQWLKPLANRWLATAAWGIIALVWLTVRVMKRLQLLEKQQKQQREE
AIDPLSVELNAQQRYLDRWLLRLQRHLDNRRFLWQLPWYMVIGPAGSGKTTLLREGFPSDIIYAPEGARG
TEQRLYLTPHVGKQAVIFDIDGTLCAPADADILHRRLWEHALGWLKEKRARQPLNGIILTLDLPDLLTAD
KRHREHLLQTLRSRLQDIRQHLHCQLPVYVVLTRLDLLQGFAALFQSLNRQDRDAILGVTFTRRAHENDD
WRTELNAFWQTWVDRMNLALPDLMVTQTHTRASLFSFSRQMQGSREPLVSLLEGLLDGENMNVMLRGVYL
TSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPYFTRSLFPQALLAEPNLATESRAWLMRSRRRL
TVFSATGGVAALLLITGWHHYYNGNYQSGITVLKQAKAFMDVPPPQGEDDYGNLQLPLLNPVRDATLAYG
DWGDRSRLADMGLYQGRRIGPYVEQTYLQLLEQRYLPSLFNGLVKAMNAAPPESEEKLAVLRVMRMLEDK
SGRNNEVVKQYMAKRWSEKFHGQRDIQAQLMSHLDYALAHTDWHAERQAGDGDAISRWTPYDKPVVSAQK
ELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQVFTSADDNKLVVPQFLTRYGLQSYFVKQRDE
LVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISDYTATWRAGMDNLNIRNFESIGQLTGALEQVI
SGDQPLQRALTVLRDNTQPGVFSEKLSAKERDEALAEPDYQLLTRLGHEFAPENITLAVQKDKESTMQAV
YQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPIFATRQMAKTLPAPLNRWVGRLTDQAWHVVM
VEAVHYMEVDWRDSVVKPFNEQLANNYPFNPRSAQDASLDAFERFFKPDGILDTFYQQNLKLFIDNDLSL
EDGDNNVIIREDIIAQLETAQKIRDIFFSKQNGLGTSFAVETVSLSGNKRRSVLNLDGQLVDYSQGRNYT
AHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFRLFGAGQLTGVQDGNFTVRFSVDGGAMTYRV
HTDTEDNPFSGGLFSQFGLSDTLY
 
Nucleotide Sequence: 3435 bp     [Download]
>gi|16445223|ref|NC_002655.2|:c248833-245399 Escherichia coli O157:H7 str. EDL933 chromosome, complete genome
TTGCTGATACTGGCGTGGATTTTTCTGCTGGTATGGATCTGGTGGAAAGGCCCGACGTGGACGCTGTATG
AAGAACAGTGGCTCAAACCACTGGCGAACCGCTGGCTGGCAACGGCGGCGTGGGGGATTATTGCCCTGGT
GTGGCTTACCGTCCGGGTAATGAAGCGCCTGCAACTGCTTGAAAAACAGCAAAAACAGCAGCGCGAAGAG
GCCATTGATCCGCTCAGTGTGGAGCTGAACGCCCAGCAGCGTTACCTTGACCGCTGGCTGCTGCGCCTGC
AACGCCATCTCGACAACCGCCGTTTCCTGTGGCAGTTACCGTGGTATATGGTCATCGGCCCGGCGGGCAG
TGGCAAAACGACACTGCTGCGCGAGGGGTTTCCGTCAGACATTATTTATGCCCCGGAGGGCGCGCGCGGC
ACAGAACAACGCCTGTACCTTACGCCCCATGTCGGTAAACAGGCGGTGATCTTTGATATCGACGGCACAC
TCTGCGCTCCCGCTGATGCGGATATCCTGCATCGCCGTCTGTGGGAACATGCCCTCGGCTGGCTGAAAGA
AAAGCGCGCGCGCCAGCCGCTGAACGGGATTATTCTGACACTCGATTTACCCGATCTGCTGACCGCAGAC
AAACGCCACCGCGAGCATCTGTTACAGACGCTGCGCAGCCGCTTACAGGATATACGCCAGCATCTTCACT
GCCAGTTACCGGTTTACGTGGTACTGACCCGGCTTGATTTATTACAGGGTTTTGCCGCCCTGTTCCAGTC
CCTGAACAGACAGGATCGCGATGCGATTCTGGGCGTCACGTTCACCCGCCGTGCCCATGAAAATGATGAC
TGGCGAACAGAGTTGAATGCTTTCTGGCAGACATGGGTGGATCGAATGAATCTGGCGTTGCCGGATCTGA
TGGTCACCCAGACTCACACCCGCGCGTCTTTATTCAGTTTTTCCCGCCAGATGCAGGGAAGCCGTGAACC
GCTGGTGTCACTGCTTGAGGGTCTGCTTGACGGTGAAAATATGAACGTGATGCTGCGTGGTGTCTATCTC
ACCTCTTCGCTTCAGCGCGGGCAGATGGATGATATATTCACCCAGTCTGCCGCCCGCCAGTACCGACTGG
GCAATAACCCACTGGCGTCCTGGCCTCTGGTGGACACCGCGCCTTATTTCACCCGCAGCTTGTTCCCGCA
GGCATTACTCGCAGAGCCTAATCTGGCAACGGAGAGCCGCGCCTGGCTGATGCGTTCCCGTCGCCGCCTG
ACGGTTTTCTCTGCCACCGGCGGCGTGGCGGCACTGCTGCTCATCACCGGCTGGCATCACTATTACAACG
GTAACTATCAGTCCGGCATCACCGTGCTTAAGCAGGCCAAAGCCTTTATGGATGTGCCGCCTCCACAGGG
GGAAGATGACTACGGCAACCTGCAACTGCCGCTGCTGAACCCGGTACGCGATGCCACACTGGCCTATGGC
GACTGGGGCGACCGCAGCCGTCTGGCCGATATGGGACTGTACCAGGGACGACGTATCGGACCTTATGTGG
AACAGACCTATCTGCAACTGCTGGAGCAACGTTACCTGCCCTCGCTGTTTAACGGGCTGGTTAAAGCGAT
GAATGCCGCGCCGCCGGAGAGTGAAGAAAAACTCGCGGTGCTGCGCGTGATGCGAATGCTGGAGGACAAA
AGCGGACGTAACAATGAGGTGGTGAAGCAGTATATGGCAAAACGCTGGAGCGAAAAGTTCCACGGCCAGC
GCGATATCCAGGCACAACTGATGTCCCATCTTGACTACGCGCTGGCTCATACTGACTGGCACGCAGAGCG
TCAGGCGGGCGACGGTGACGCCATCAGCCGCTGGACGCCATATGACAAGCCCGTGGTATCAGCACAGAAA
GAACTGAGCAAACTGCCTGTCTACCAGCGGGTTTACCAGAGCCTGAAAACGCGGGCGCTGGGCGTTCTTC
CTGCCGACCTCAATCTGCGTGACCAGGTAGGGCCAACCTTTGACCAGGTGTTTACATCTGCCGATGACAA
CAAACTGGTTGTTCCACAGTTTCTTACCCGTTACGGCCTGCAAAGCTATTTTGTAAAACAGCGCGATGAA
CTGGTTGAACTGACGGCGATGGATTCCTGGGTACTTAACCTTACCCGCAGCGTGAAATACAGTGACGCCG
ACCGCGCGGAAATCCAGCGCCAGCTCACCGAGCAGTATATCAGCGACTACACCGCCACCTGGCGGGCCGG
GATGGACAATCTGAATATCCGCAATTTTGAGTCCATCGGACAACTGACCGGGGCGCTGGAGCAGGTTATC
AGCGGCGACCAGCCTTTGCAGCGGGCGCTGACCGTGCTGCGTGACAACACACAGCCAGGCGTCTTTTCTG
AAAAACTCTCTGCCAAAGAACGGGATGAGGCCCTGGCAGAGCCGGACTACCAGTTACTCACCCGTCTCGG
GCATGAGTTCGCCCCGGAAAACATTACCCTGGCAGTACAGAAAGACAAAGAAAGCACGATGCAGGCCGTG
TATCAGCAACTCACCGAGTTGCACCGCTACCTGCTGGCAATCCAGAACGCGCCTGTACCAGGGAAATCGG
CGCTGAAAGCCGTGCAGTTACGGCTTGATCAGAACAGCAGCGATCCGATATTCGCCACCCGCCAGATGGC
AAAAACGCTGCCTGCTCCGCTCAACCGCTGGGTTGGCAGACTGACTGACCAGGCCTGGCATGTGGTGATG
GTGGAGGCTGTACATTATATGGAAGTGGACTGGCGCGACAGCGTGGTGAAACCGTTTAACGAGCAACTGG
CAAATAACTATCCGTTTAATCCGCGTTCTGCACAGGATGCCTCACTGGATGCCTTCGAACGCTTCTTTAA
ACCGGATGGCATACTGGATACCTTCTACCAGCAGAACCTGAAGCTGTTTATCGATAATGACCTGAGTCTG
GAGGATGGCGATAACAACGTCATTATTCGCGAAGATATTATTGCGCAACTGGAAACTGCGCAGAAAATCC
GTGACATCTTCTTCAGCAAACAGAACGGTCTGGGAACATCCTTTGCCGTGGAAACGGTATCGCTTTCAGG
CAATAAACGCCGCAGTGTACTGAACCTTGACGGTCAGTTAGTCGATTACAGCCAGGGCCGTAACTATACC
GCCCATCTGGTCTGGCCTAACAACATGCGCGAAGGCAACGAAAGTAAGCTGACGCTCATCGGCACCAGCG
GCAACGCGCCGCGCAGTATCAGCTTCAGCGGGCCGTGGGCGCAGTTCCGCCTGTTCGGGGCCGGACAACT
GACCGGAGTACAGGATGGCAACTTTACCGTGCGCTTTAGCGTGGACGGTGGCGCGATGACCTACCGTGTG
CATACCGACACGGAAGATAACCCGTTCAGCGGTGGGTTGTTCAGCCAGTTTGGTCTGTCAGACACACTGT
ACTGA
 Primer design