SecReT6
Protein ID: 15829472
SecReT6 ID8
T6SS typei1
Gene symbol-
Locus tagECs0218
StrainEscherichia coli O157:H7 str. Sakai
Repliconchromosome [GenBank: NC_002695] [Browse all T6SS(s) in this replicon]
Location [Strand]245398..248505 [-]
ProductIcmF-like protein
NoteTssM
UniProt IDQ7AHJ7
KEGG IDecs:ECs0218
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.40E-85, Aligned region: 184..225
IcmF-related [PF06761], Evalue: 4.40E-85, Aligned region: 366..679
ImcF-related_N [PF14331], Evalue: 2.40E-62, Aligned region: 66..316
DUF1215 [PF06744], Evalue: 8.80E-34, Aligned region: 165..183
DUF1215 [PF06744], Evalue: 8.80E-34, Aligned region: 775..894
AAA_22 [PF13401], Evalue: 0.0002, Aligned region: 2..134
AAA_22 [PF13401], Evalue: 0.0002, Aligned region: 717..748
Protein Sequence: 1035 a.a.     [Download]
>gi|15829472|ref|NP_308245.1| IcmF-like protein [Escherichia coli O157:H7 str. Sakai]
MVIGPAGSGKTTLLREGFPSDIIYAPEGARGTEQRLYLTPHVGKQAVIFDIDGTLCAPADADILHRRLWE
HALGWLKEKRARQPLNGIILTLDLPDLLTADKRHREHLLQTLRSRLQDIRQHLHCQLPVYVVLTRLDLLQ
GFAALFQSLNRQDRDAILGVTFTRRAHENDDWRTELNAFWQTWVDRMNLALPDLMVTQTHTRASLFSFSR
QMQGSREPLVSLLEGLLDGENMNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPY
FTRSLFPQALLAEPNLATESRAWLMRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQSGITVLKQAKAF
MDVPPPQGEDDYGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRIGPYVEQTYLQLLEQRYLPSL
FNGLVKAMNAAPPESEEKLAVLRVMRMLEDKSGRNNEVVKQYMAKRWSEKFHGQRDIQAQLMSHLDYALA
HTDWHAERQAGDGDAISRWTPYDKPVVSAQKELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQ
VFTSADDNKLVVPQFLTRYGLQSYFVKQRDELVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISD
YTATWRAGMDNLNIRNFESIGQLTGALEQVISGDQPLQRALTVLRDNTQPGVFSEKLSAKERDEALAEPD
YQLLTRLGHEFAPENITLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDP
IFATRQMAKTLPAPLNRWVGRLTDQAWHVVMVEAVHYMEVDWRDSVVKPFNEQLANNYPFNPRSAQDASL
DAFERFFKPDGILDTFYQQNLKLFIDNDLSLEDGDNNVIIREDIIAQLETAQKIRDIFFSKQNGLGTSFA
VETVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQF
RLFGAGQLTGVQDGNFTVRFSVDGGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY
 
Nucleotide Sequence: 3108 bp     [Download]
>gi|15829254|ref|NC_002695.1|:c248505-245398 Escherichia coli O157:H7 str. Sakai chromosome, complete genome
ATGGTCATCGGCCCGGCGGGCAGTGGCAAAACGACACTGCTGCGCGAGGGGTTTCCGTCAGACATTATTT
ATGCCCCGGAGGGCGCGCGCGGCACAGAACAACGCCTGTACCTTACGCCCCATGTCGGTAAACAGGCGGT
GATCTTTGATATCGACGGCACACTCTGCGCTCCCGCTGATGCGGATATCCTGCATCGCCGTCTGTGGGAA
CATGCCCTCGGCTGGCTGAAAGAAAAGCGCGCGCGCCAGCCGCTGAACGGGATTATTCTGACACTCGATT
TACCCGATCTGCTGACCGCAGACAAACGCCACCGCGAGCATCTGTTACAGACGCTGCGCAGCCGCTTACA
GGATATACGCCAGCATCTTCACTGCCAGTTACCGGTTTACGTGGTACTGACCCGGCTTGATTTATTACAG
GGTTTTGCCGCCCTGTTCCAGTCCCTGAACAGACAGGATCGCGATGCGATTCTGGGCGTCACGTTCACCC
GCCGTGCCCATGAAAATGATGACTGGCGAACAGAGTTGAATGCTTTCTGGCAGACATGGGTGGATCGAAT
GAATCTGGCGTTGCCGGATCTGATGGTCACCCAGACTCACACCCGCGCGTCTTTATTCAGTTTTTCCCGC
CAGATGCAGGGAAGCCGTGAACCGCTGGTGTCACTGCTTGAGGGTCTGCTTGACGGTGAAAATATGAACG
TGATGCTGCGTGGTGTCTATCTCACCTCTTCGCTTCAGCGCGGGCAGATGGATGATATATTCACCCAGTC
TGCCGCCCGCCAGTACCGACTGGGCAATAACCCACTGGCGTCCTGGCCTCTGGTGGACACCGCGCCTTAT
TTCACCCGCAGCTTGTTCCCGCAGGCATTACTCGCAGAGCCTAATCTGGCAACGGAGAGCCGCGCCTGGC
TGATGCGTTCCCGTCGCCGCCTGACGGTTTTCTCTGCCACCGGCGGCGTGGCGGCACTGCTGCTCATCAC
CGGCTGGCATCACTATTACAACGGTAACTATCAGTCCGGCATCACCGTGCTTAAGCAGGCCAAAGCCTTT
ATGGATGTGCCGCCTCCACAGGGGGAAGATGACTACGGCAACCTGCAACTGCCGCTGCTGAACCCGGTAC
GCGATGCCACACTGGCCTATGGCGACTGGGGCGACCGCAGCCGTCTGGCCGATATGGGACTGTACCAGGG
ACGACGTATCGGACCTTATGTGGAACAGACCTATCTGCAACTGCTGGAGCAACGTTACCTGCCCTCGCTG
TTTAACGGGCTGGTTAAAGCGATGAATGCCGCGCCGCCGGAGAGTGAAGAAAAACTCGCGGTGCTGCGCG
TGATGCGAATGCTGGAGGACAAAAGCGGACGTAACAATGAGGTGGTGAAGCAGTATATGGCAAAACGCTG
GAGCGAAAAGTTCCACGGCCAGCGCGATATCCAGGCACAACTGATGTCCCATCTTGACTACGCGCTGGCT
CATACTGACTGGCACGCAGAGCGTCAGGCGGGCGACGGTGACGCCATCAGCCGCTGGACGCCATATGACA
AGCCCGTGGTATCAGCACAGAAAGAACTGAGCAAACTGCCTGTCTACCAGCGGGTTTACCAGAGCCTGAA
AACGCGGGCGCTGGGCGTTCTTCCTGCCGACCTCAATCTGCGTGACCAGGTAGGGCCAACCTTTGACCAG
GTGTTTACATCTGCCGATGACAACAAACTGGTTGTTCCACAGTTTCTTACCCGTTACGGCCTGCAAAGCT
ATTTTGTAAAACAGCGCGATGAACTGGTTGAACTGACGGCGATGGATTCCTGGGTACTTAACCTTACCCG
CAGCGTGAAATACAGTGACGCCGACCGCGCGGAAATCCAGCGCCAGCTCACCGAGCAGTATATCAGCGAC
TACACCGCCACCTGGCGGGCCGGGATGGACAATCTGAATATCCGCAATTTTGAGTCCATCGGACAACTGA
CCGGGGCGCTGGAGCAGGTTATCAGCGGCGACCAGCCTTTGCAGCGGGCGCTGACCGTGCTGCGTGACAA
CACACAGCCAGGCGTCTTTTCTGAAAAACTCTCTGCCAAAGAACGGGATGAGGCCCTGGCAGAGCCGGAC
TACCAGTTACTCACCCGTCTCGGGCATGAGTTCGCCCCGGAAAACATTACCCTGGCAGTACAGAAAGACA
AAGAAAGCACGATGCAGGCCGTGTATCAGCAACTCACCGAGTTGCACCGCTACCTGCTGGCAATCCAGAA
CGCGCCTGTACCAGGGAAATCGGCGCTGAAAGCCGTGCAGTTACGGCTTGATCAGAACAGCAGCGATCCG
ATATTCGCCACCCGCCAGATGGCAAAAACGCTGCCTGCTCCGCTCAACCGCTGGGTTGGCAGACTGACTG
ACCAGGCCTGGCATGTGGTGATGGTGGAGGCTGTACATTATATGGAAGTGGACTGGCGCGACAGCGTGGT
GAAACCGTTTAACGAGCAACTGGCAAATAACTATCCGTTTAATCCGCGTTCTGCACAGGATGCCTCACTG
GATGCCTTCGAACGCTTCTTTAAACCGGATGGCATACTGGATACCTTCTACCAGCAGAACCTGAAGCTGT
TTATCGATAATGACCTGAGTCTGGAGGATGGCGATAACAACGTCATTATTCGCGAAGATATTATTGCGCA
ACTGGAAACTGCGCAGAAAATCCGTGACATCTTCTTCAGCAAACAGAACGGTCTGGGAACATCCTTTGCC
GTGGAAACGGTATCGCTTTCAGGCAATAAACGCCGCAGTGTACTGAACCTTGACGGTCAGTTAGTCGATT
ACAGCCAGGGCCGTAACTATACCGCCCATCTGGTCTGGCCTAACAACATGCGCGAAGGCAACGAAAGTAA
GCTGACGCTCATCGGCACCAGCGGCAACGCGCCGCGCAGTATCAGCTTCAGCGGGCCGTGGGCGCAGTTC
CGCCTGTTCGGGGCCGGACAACTGACCGGAGTACAGGATGGCAACTTTACCGTGCGCTTTAGCGTGGACG
GTGGCGCGATGACCTACCGTGTGCATACCGACACGGAAGATAACCCGTTCAGCGGTGGGTTGTTCAGCCA
GTTTGGTCTGTCAGACACACTGTACTGA
 Primer design