SecReT6
Protein ID: 158424221
SecReT6 ID235
T6SS typei5
Gene symbolimcF
Locus tagAZC_2597
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T6SS(s) in this replicon]
Location [Strand]2927404..2930946 [+]
ProductImcF-related protein
NoteTssM
UniProt IDA8IB20
KEGG IDazc:AZC_2597
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 8.20E-65, Aligned region: 503..808
ImcF-related_N [PF14331], Evalue: 5.10E-54, Aligned region: 194..447
DUF1215 [PF06744], Evalue: 9.00E-33, Aligned region: 923..1040
DUF4131 [PF13567], Evalue: 0.0078, Aligned region: 6..75
Protein Sequence: 1180 a.a.     [Download]
>gi|158424221|ref|YP_001525513.1| imcF gene product [Azorhizobium caulinodans ORS 571]
MQMTLTTWTFWRWVLLFAAAAVFALLVWLLGPRLSFDGVSPFAGVTPRVMTTLIIVLLAGLVALYWALNQ
RHPATASETTKPSAPKKALPALEAPTASRAQREAMERGFQLALGVLKRIRTPGFFNRSYKYELPWYAIIG
AEQAGKSALIRASGLRFPLNEARNGQINGGTISLSFTDQAVLIETRGPMVPPSEENTWGLFGLLLKRYRH
RQPINGIVLVLSLSDMMRATDAERFSLHADLRDQLERFQATVKARVPIYVVFTKADIIPGFDEFCADLTS
VERQGVFGVTLPLYDERGITTRGKPLPATFSAEFDNFLRWQMPRMASQVSQGFGVGPRFDCFMMLPHLAT
VKPLIADLIEDVFKPTTYDRPLLLRGFYFTSTQATSPRDANALPPAGTPDPAATRKTGLFIHDLFDKVIF
KEAGLVEHDPTVRRNENVLRWGIATAGITLSLALLSWMTISFVANRYLIGEVERATDRTKTAIAALDANP
TVQPSAETDFASVLPVLNSLAGLPTGWDARHQHVAWQLEGALGQKRYLAEATRQEYVEGLEALLTPRVII
ALQREIAANMRNPDALYQALKVYLMLGHAGPMDRTVVVTWMHNLLANIYPGPTQAPLRNALLEHVENMLE
VGVPPIELEQELISQARAVLNAYPAANQGMAILQNRSEIRALPVWRVTDVAGPLAPYALARRSGRPLNEP
IDGMYTSAAFFPVVIPAISEVASSIISDDWVRFPSTPSAPEAARISQLTRDMTDLYVNDYISVWQNMVSD
VTLAGFDNLQAELAVLQAALGPPSPLSSYLQAVTKETTIELPEAAGGAAKAVGTAAAAVAGPAAGAVNAV
LQSGNARMKALAQSVTSRFSDLHTFASGTPSPLDEVLRSMSQLRALLGPAASMGGADPAQITEMTSGPQF
AQILSQLKLNTLTAPPALTDSIVSLVRQTSTIANAGVKADLDSAWKTQVLPFCQAAINGKFPFSNSPNDV
TLADFARMFAPDGLMDQFFNKQLKNFVDTLSSPWRPLTNVATHPDISPAGLAVFEQAAKIRAVFFPNGGT
TPEVSFSITPTDLDPGAMRVKVEIDGQSFIYQYGPTVPTAMKWPGNVGSVRVEFGVGGDSGPAAVSYTGP
FALFRFLAGRGVNRISPTRINFGVTLGPRSASFALDAASVNNPFQRPPYAGFRCPTSLVQ
 
Nucleotide Sequence: 3543 bp     [Download]
>gi|158421624|ref|NC_009937.1|:2927404-2930946 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGCAAATGACCCTCACCACATGGACATTCTGGCGCTGGGTGCTGCTGTTCGCCGCGGCGGCCGTCTTCG
CGCTGCTGGTGTGGCTCCTCGGGCCGCGCCTGTCCTTTGACGGGGTCTCTCCCTTCGCGGGCGTCACGCC
GCGCGTGATGACCACGCTCATCATCGTGCTGCTGGCCGGCCTCGTCGCGCTCTACTGGGCTCTCAATCAG
CGCCATCCCGCCACCGCCAGCGAGACGACAAAGCCCAGCGCCCCGAAAAAGGCGCTGCCGGCCCTCGAAG
CGCCGACCGCCTCGCGGGCGCAGCGGGAGGCGATGGAACGCGGATTCCAGCTGGCGCTCGGCGTGCTGAA
GCGCATCCGCACGCCGGGCTTCTTCAACCGCAGCTACAAATATGAACTGCCCTGGTACGCCATCATCGGC
GCCGAGCAGGCCGGCAAGAGTGCCCTCATCCGCGCGTCAGGCCTGCGCTTTCCGCTGAACGAGGCGCGCA
ACGGCCAGATCAACGGCGGCACCATCAGCCTGTCCTTCACGGATCAGGCGGTGCTCATCGAGACCCGCGG
GCCCATGGTCCCGCCCTCGGAGGAGAACACCTGGGGCCTGTTCGGCCTGCTGCTGAAGCGCTACCGCCAC
CGCCAGCCCATCAACGGCATCGTGCTCGTGCTCTCGCTCAGCGACATGATGCGGGCGACCGACGCCGAGC
GCTTTTCCCTCCATGCCGATCTGCGCGACCAGCTGGAGCGCTTCCAGGCCACCGTGAAGGCCCGCGTGCC
GATCTACGTGGTCTTCACAAAGGCCGACATCATCCCCGGCTTCGACGAATTCTGCGCCGACCTGACCTCC
GTCGAGCGGCAGGGCGTGTTCGGCGTGACGCTGCCGCTCTATGACGAGCGCGGCATCACCACGCGCGGCA
AGCCGCTGCCCGCCACCTTCTCCGCGGAATTCGACAATTTCCTGCGCTGGCAGATGCCGCGCATGGCGAG
CCAGGTGAGCCAGGGCTTCGGCGTCGGTCCGCGCTTCGACTGCTTCATGATGCTGCCGCATCTGGCCACG
GTGAAGCCGCTGATCGCCGACCTCATCGAGGACGTGTTCAAGCCCACCACCTACGACCGCCCCCTGCTGC
TGCGCGGCTTCTATTTCACCAGCACGCAGGCGACCTCGCCGCGCGACGCCAATGCGCTGCCGCCCGCCGG
CACGCCGGACCCTGCCGCCACCCGCAAGACCGGCCTGTTCATCCACGATTTGTTCGACAAGGTGATCTTC
AAGGAGGCCGGCCTCGTCGAGCATGACCCGACCGTGCGCCGCAACGAGAACGTGCTGCGCTGGGGCATCG
CCACGGCGGGCATCACGCTCAGCCTCGCCCTCCTGTCCTGGATGACCATCAGCTTCGTGGCCAACCGTTA
CCTGATCGGGGAAGTGGAGCGGGCGACCGACCGCACCAAGACGGCCATCGCCGCCCTCGACGCCAATCCC
ACCGTCCAACCGAGCGCGGAGACCGACTTCGCATCGGTCCTGCCGGTGCTGAACAGCCTTGCGGGGCTGC
CCACGGGCTGGGATGCCCGCCATCAGCATGTCGCCTGGCAGCTCGAAGGCGCACTCGGGCAGAAGCGCTA
CCTCGCCGAGGCCACGCGCCAGGAATATGTGGAAGGGCTCGAAGCCCTGCTCACGCCGCGCGTCATCATC
GCCCTGCAGCGGGAAATTGCCGCCAACATGCGCAATCCCGATGCGCTCTATCAGGCGCTGAAGGTCTATC
TCATGCTGGGCCACGCCGGCCCCATGGACCGCACCGTGGTCGTGACCTGGATGCACAACCTGCTCGCCAA
TATCTATCCGGGTCCCACGCAGGCGCCGCTGCGCAACGCGCTGCTCGAGCATGTGGAAAACATGCTGGAA
GTCGGCGTGCCGCCCATCGAGCTGGAACAGGAGCTCATCAGCCAGGCCCGGGCCGTCCTCAACGCCTATC
CGGCGGCCAATCAGGGCATGGCGATCCTGCAGAACCGCAGCGAGATCCGCGCCCTGCCCGTCTGGCGCGT
CACCGACGTGGCCGGTCCCCTCGCCCCTTATGCGCTGGCGCGCCGCTCCGGGCGCCCGCTCAACGAGCCG
ATCGACGGCATGTACACATCGGCGGCCTTCTTTCCGGTGGTCATACCGGCCATCTCGGAGGTCGCCAGTT
CCATCATCTCCGACGACTGGGTGCGCTTTCCCTCGACGCCCTCCGCTCCGGAGGCGGCCCGCATCTCGCA
GCTCACGCGCGACATGACGGACCTCTATGTCAACGACTACATCTCCGTCTGGCAGAACATGGTGAGCGAC
GTGACGCTCGCCGGCTTCGACAACCTGCAGGCGGAACTCGCCGTGCTCCAGGCCGCCCTCGGCCCGCCCT
CGCCGCTGTCGAGCTATCTCCAGGCGGTGACCAAGGAAACGACCATCGAACTGCCGGAAGCGGCGGGCGG
CGCGGCCAAGGCCGTCGGCACTGCGGCAGCTGCCGTCGCCGGGCCGGCCGCGGGCGCCGTCAATGCGGTC
CTGCAATCCGGCAATGCGCGCATGAAAGCACTGGCCCAGTCCGTCACATCCCGCTTCTCGGATCTCCACA
CCTTCGCCAGCGGAACCCCGAGCCCGCTCGACGAGGTGCTGCGCTCCATGAGCCAGTTGCGCGCCCTCCT
CGGCCCCGCCGCCAGCATGGGCGGCGCGGACCCCGCGCAGATTACCGAGATGACCTCGGGCCCGCAGTTC
GCGCAGATCCTCTCGCAACTGAAGCTGAACACGCTCACGGCGCCGCCGGCATTGACGGATTCCATCGTCT
CGCTGGTCCGCCAGACCTCGACCATCGCCAATGCCGGCGTGAAGGCGGATCTCGACAGCGCCTGGAAGAC
GCAGGTCCTGCCCTTCTGCCAGGCGGCCATCAACGGCAAGTTCCCGTTCTCCAACTCGCCGAACGACGTG
ACCCTGGCCGACTTCGCCCGCATGTTCGCCCCCGACGGGCTCATGGACCAGTTCTTCAACAAGCAGTTGA
AGAACTTCGTGGACACGCTGAGTTCGCCGTGGCGCCCGCTGACCAATGTCGCGACCCACCCGGACATTTC
GCCGGCCGGCCTCGCCGTGTTCGAGCAGGCGGCGAAGATCCGCGCCGTCTTCTTCCCCAATGGCGGCACG
ACCCCGGAAGTCAGCTTCTCCATCACGCCGACCGATCTCGACCCCGGTGCCATGCGGGTGAAGGTGGAGA
TCGACGGCCAGTCCTTCATCTACCAGTACGGCCCGACGGTGCCGACGGCGATGAAGTGGCCGGGCAACGT
CGGTTCCGTGCGCGTGGAATTCGGCGTCGGCGGCGACAGCGGACCGGCGGCGGTGAGCTACACGGGCCCG
TTCGCGCTGTTCCGCTTCCTGGCCGGACGGGGCGTGAACCGCATCAGCCCGACCCGCATCAATTTCGGCG
TCACGCTCGGCCCCCGCTCCGCGAGCTTCGCGCTCGACGCGGCAAGCGTGAACAATCCCTTCCAGCGGCC
GCCGTACGCGGGCTTCCGCTGCCCGACATCCCTCGTTCAGTAG
 Primer design