SecReT6
Protein ID: 158512122
SecReT6 ID791
T6SS typei4b
Gene symbolevpO
Locus tagEvpO
StrainEdwardsiella tarda PPD130/91
Repliconchromosome [GenBank: AY424360] [Browse all T6SS(s) in this replicon]
Location [Strand]20608..24399 [+]
ProductEvpO
NoteTssM
UniProt IDA8YQS1, A8YQS1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.90E-52, Aligned region: 172..426
DUF1215 [PF06744], Evalue: 0.0016, Aligned region: 941..991
DUF1215 [PF06744], Evalue: 0.0016, Aligned region: 1009..1025
Protein Sequence: 1263 a.a.     [Download]
>gi|158512122|ref|ABW69087.1| EvpO [Edwardsiella tarda]
MAAMKRLFKWIAIVVLLSVLAMLCWLLTLWQRWPAAAAWVLFLAILAGALLTRYLWRKVRAWRTRSLEAE
PVEKARAAERHPMTLQRQWKAATTLLKHSQLRRFRHPLQVLPWFMLLGRPGSGKSALLAQSGLAAPLDLP
HELNDGKALVDWWYFDKAVILDISGQFVQPEASQETRSTWNRMLDLLGRDRARAGLNGLVLTVSAQTLLS
ADGGGVVDEGRLIRTRIEQLIRLFDRRFPVYVLVTQIDSLYGMEAWSHLLTPEALDQAMGHVVDEPENGR
DVRDVIDIALGRVNSRLKTMQLTMLLQHPDADPALLMFPTELARLAEPLKRYVYHALGDSPYLESPILRG
VFFASAVQKGNTRSGPEDQQEIALQEAAHDTVKRGVFVRDLFNRVLPADRHLNRPVAVTSPWRRLNRHLG
LFAWWLCVAAALGYLGVSVVYWQHTLDDLRQRYPATMAMNRALPHDMQMMIAQRDAIYWLENRNAQWASR
VLAFQHQLLSVEADAKSQYVNDFSQYILPSLDKAIQQSTTADSIASHPDGLVNAIQVEVRRANLLRARLR
GSSYGALMAMPPIPTPPLRLLYPALDSDTVSRFNDLFLAQLAWSTDIQQQNARLLHLQARLRQLAAQSAT
LDWIIPWANAQPDLTNVTLDDFWQGSLRPDKLPEVDAAYTLEGQQRIRAFLVEMRSSMPNDIAFDKKRAA
FWHEYAQKRLQAWQDFAGQFSQGERILAGQGEWQSTIDRLPHDDNPYLRLARRLLTEFAEMPDDLRPGWL
RVLPQWLEIRQRAHQQALVRVPGLVSDVGGMILRGTAQKGALDQTRSQLVGRLDAIRLYQEYQAAMTQAM
NSVVISQAQATKVAADFHGFDSQQSGQSSLQTAYARLMSLRSLLGYNRPDEQLTWGLMAGPLQLVIRYAD
QQASCFLQSAWQDRVIAPSRWTLNQAERADKLYGDNGLLWTFLSGPIKPFIQRNDSGWQEVDTLGQSVPF
TADFLPFINRALIRQVDLKAGKIALHQKQQQATLAQQQQKQRWQTVAAESGEKLAELNTAAAALKAKSYP
VALTGLPTDVNSNAKAKVVGTLLTMQCTNATLRLNNLNFAVMQSVLWSQQQCGQVTLQIRLPTFTLTRSY
PGPQGFVHFLRDFPGGARRFTPADFPVDKSRMAAVGLTQITVRYRIAGQETLLQDAAQLAQAERDIQSAQ
TRQQQAQQALLTLNRPSASESLPPLDTLPGLTMMSVPERIGQCWRGDIRLARENDGIGRLMSELVAKQLS
DKP
 
Nucleotide Sequence: 3792 bp     [Download]
>gi|158512110|gb|AY424360|evpO|:20608-24399
GTGGCTGCCATGAAACGTCTCTTCAAATGGATAGCGATTGTCGTGCTCCTGAGCGTACTGGCGATGCTGT
GCTGGCTGCTCACGCTGTGGCAACGCTGGCCCGCCGCCGCCGCATGGGTGCTGTTTCTCGCCATTCTGGC
CGGCGCCCTGCTGACCCGCTATCTCTGGCGTAAGGTGCGGGCATGGCGTACCCGCAGCCTGGAGGCGGAG
CCGGTTGAAAAAGCCCGAGCCGCGGAGCGCCATCCCATGACGCTACAGCGCCAGTGGAAAGCCGCCACGA
CCCTGCTGAAGCACTCTCAGCTGCGCCGGTTCCGCCACCCGCTGCAGGTTCTGCCCTGGTTTATGCTGCT
GGGCCGCCCGGGATCGGGAAAATCGGCGCTGCTGGCGCAGTCGGGCCTGGCCGCCCCCTTGGATTTGCCC
CATGAGCTCAATGACGGCAAGGCGCTCGTCGACTGGTGGTATTTCGACAAGGCCGTCATCCTGGATATCT
CTGGCCAGTTCGTACAGCCGGAGGCATCGCAGGAGACCCGCTCCACCTGGAACCGGATGCTGGATCTGCT
GGGGCGCGATCGCGCCCGGGCCGGATTGAACGGGCTGGTGCTCACGGTATCGGCCCAGACCCTGCTGTCC
GCAGACGGGGGCGGCGTGGTCGACGAGGGACGGCTGATCCGCACTCGCATAGAGCAGCTGATCCGTCTGT
TCGATAGGCGCTTCCCCGTCTACGTGCTGGTGACCCAAATCGACAGCCTGTACGGCATGGAGGCCTGGTC
CCACCTGCTGACCCCGGAGGCGCTGGATCAGGCCATGGGCCATGTGGTGGACGAACCGGAGAACGGCCGC
GACGTCCGCGACGTGATAGATATCGCCTTGGGTCGGGTCAATAGCCGGCTGAAAACCATGCAGCTGACGA
TGCTGCTGCAGCACCCGGATGCCGATCCGGCCTTACTGATGTTCCCCACCGAGCTGGCCAGGCTGGCCGA
GCCCCTCAAGCGCTATGTCTATCATGCTCTGGGAGACAGCCCCTATCTGGAGTCGCCCATCTTGCGCGGC
GTATTCTTCGCCAGCGCGGTCCAGAAGGGAAACACCCGCAGCGGGCCCGAAGATCAGCAGGAGATTGCGC
TGCAGGAGGCGGCGCATGACACCGTCAAACGCGGGGTCTTTGTCCGGGATCTGTTTAACCGCGTCCTGCC
GGCCGACCGTCATCTAAACCGCCCCGTCGCCGTGACCAGTCCCTGGCGGCGCCTGAACCGCCATCTGGGC
CTGTTCGCCTGGTGGCTGTGCGTGGCCGCCGCCCTCGGGTATCTCGGCGTATCGGTCGTGTACTGGCAGC
ACACGCTGGACGATCTGCGCCAGCGCTATCCGGCGACCATGGCCATGAATCGCGCCCTGCCCCACGACAT
GCAGATGATGATAGCCCAGCGGGATGCGATTTATTGGCTGGAAAACAGAAACGCGCAGTGGGCCAGCCGG
GTACTGGCATTCCAGCATCAGCTGCTCTCGGTTGAAGCGGATGCAAAATCGCAGTATGTAAATGACTTTA
GCCAATATATTTTACCCAGCCTGGACAAGGCGATTCAGCAGAGCACCACGGCGGACAGCATCGCATCCCA
TCCCGACGGGCTGGTGAACGCCATTCAGGTGGAGGTCCGCCGCGCCAACCTGCTACGGGCGAGGCTGCGA
GGCTCCAGCTACGGGGCGCTGATGGCCATGCCCCCGATACCGACGCCCCCCCTGCGGTTACTGTACCCGG
CGCTGGATTCGGATACGGTATCCCGTTTCAATGACCTGTTCCTGGCCCAGCTGGCCTGGTCAACGGATAT
CCAGCAGCAGAACGCCCGCCTGCTGCACCTGCAGGCGCGGCTCCGGCAGCTGGCGGCGCAAAGCGCCACC
CTGGACTGGATCATTCCCTGGGCAAACGCCCAGCCGGATCTGACCAACGTGACCCTGGACGACTTCTGGC
AGGGCTCACTGCGGCCGGATAAATTGCCGGAGGTCGATGCGGCCTACACCCTGGAGGGGCAGCAGCGTAT
CCGCGCATTCCTGGTGGAGATGCGCAGCAGCATGCCGAACGACATCGCCTTCGACAAAAAACGGGCCGCC
TTCTGGCATGAATATGCGCAGAAGCGCTTGCAGGCCTGGCAGGACTTCGCCGGACAGTTCTCTCAGGGAG
AGCGGATCCTGGCAGGTCAGGGAGAGTGGCAGAGCACCATTGACAGACTGCCCCACGATGACAACCCGTA
TCTGCGCCTTGCCCGCCGCCTGTTGACCGAGTTTGCCGAGATGCCGGATGACCTGCGCCCGGGCTGGCTC
CGGGTGCTCCCGCAGTGGCTGGAGATACGCCAGCGCGCCCACCAGCAGGCCCTCGTCAGGGTCCCCGGAC
TGGTCAGCGATGTGGGCGGCATGATCCTGCGCGGGACGGCGCAGAAGGGGGCGCTGGATCAGACCCGCAG
CCAGCTCGTCGGCCGGCTGGATGCCATCCGCCTGTATCAGGAGTATCAGGCGGCCATGACCCAGGCCATG
AACAGCGTCGTCATCAGCCAGGCCCAGGCCACCAAAGTGGCGGCGGACTTCCATGGCTTTGACAGCCAGC
AGAGCGGGCAGTCCTCACTGCAGACGGCCTATGCACGCCTGATGAGCCTGCGCAGCCTGCTGGGATACAA
TCGGCCCGATGAACAGCTCACCTGGGGGCTGATGGCGGGCCCCTTGCAGCTGGTCATTCGCTATGCCGAT
CAGCAGGCCTCCTGCTTCCTGCAGAGCGCGTGGCAGGACCGCGTCATCGCGCCATCGCGCTGGACCCTCA
ATCAGGCCGAGCGGGCGGATAAGCTGTACGGTGACAATGGGTTGCTCTGGACCTTTTTATCCGGGCCGAT
TAAGCCGTTTATCCAACGTAACGATAGCGGCTGGCAGGAGGTGGATACGCTGGGGCAGTCCGTCCCCTTT
ACCGCAGACTTCCTGCCATTCATCAACCGGGCCCTTATCCGCCAGGTTGATCTGAAGGCCGGGAAAATCG
CGCTGCACCAGAAACAGCAGCAGGCCACCCTGGCCCAGCAGCAGCAAAAGCAGCGCTGGCAAACCGTGGC
CGCCGAGTCTGGCGAAAAGCTGGCCGAGCTGAACACCGCCGCCGCCGCCCTGAAGGCGAAAAGCTATCCC
GTCGCCCTGACGGGGCTGCCGACGGACGTCAACAGCAACGCCAAGGCCAAGGTCGTGGGAACCCTGTTGA
CCATGCAGTGTACCAATGCCACGCTGCGGCTAAACAACCTTAACTTTGCCGTGATGCAAAGCGTGCTCTG
GTCACAGCAGCAGTGCGGCCAGGTGACGCTGCAGATCCGGCTCCCGACCTTCACGCTGACGCGCAGCTAT
CCCGGGCCTCAGGGCTTTGTCCACTTTTTACGGGATTTCCCGGGCGGGGCCCGCCGGTTTACCCCGGCGG
ACTTCCCCGTCGACAAAAGTCGGATGGCTGCGGTCGGGCTAACCCAGATTACGGTACGCTACCGCATCGC
CGGACAGGAGACGCTGCTGCAGGACGCCGCTCAGCTGGCGCAGGCCGAGCGCGATATTCAGTCAGCCCAG
ACCCGCCAACAGCAGGCGCAGCAGGCCCTGCTGACGCTGAATAGGCCGAGCGCATCGGAGAGCCTTCCGC
CGCTGGATACGCTGCCGGGGCTGACGATGATGAGTGTGCCGGAGCGCATCGGGCAGTGCTGGCGGGGGGA
TATTCGCCTGGCCAGAGAAAACGACGGCATTGGTCGGCTGATGAGTGAACTGGTCGCGAAACAGTTAAGC
GACAAGCCGTAA
 Primer design