SecReT6
Protein ID: 15890651
SecReT6 ID16
T6SS typei5
Gene symbolimpL
Locus tagAtu4332
StrainAgrobacterium tumefaciens str. C58
Repliconchromosome linear [GenBank: NC_003063] [Browse all T6SS(s) in this replicon]
Location [Strand]1460756..1464235 [-]
ProductIcmF family protein
NoteTssM
UniProt IDA9CGF9
KEGG IDatu:Atu4332
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.50E-76, Aligned region: 203..444
ImcF-related_N [PF14331], Evalue: 2.50E-76, Aligned region: 510..570
IcmF-related [PF06761], Evalue: 4.60E-70, Aligned region: 495..795
DUF1215 [PF06744], Evalue: 4.00E-33, Aligned region: 308..346
DUF1215 [PF06744], Evalue: 4.00E-33, Aligned region: 899..1020
Protein Sequence: 1159 a.a.     [Download]
>gi|15890651|ref|NP_356323.1| IcmF family protein [Agrobacterium tumefaciens str. C58]
MNPLSYFYTIRSYVESYAALVGRRFLSLLWVIALCVVVWFYGYLIALGDFKPLGTVQARLIAIGIIVAVW
LVYIIVTIYRGRKQDKELVDSIEREALANRQAEIGEIQTRLKEALALLRRVTKKRFGYIYDLPWYVIFGA
PGSGKTTALTNSGLQFPLGDALGENAVKGIGGTRNCNWWFADEAILIDTAGRYTTQDDLDGSSKAGWEGF
LGLLRRYRRSQPINGALVTLSIPDLLNRDPEEQRQELRSIRQRLSELDEYLHARVPVYIVLTKADLLHGF
VEFFDGFNKTDRQQVWGTTFKLDESYSAENLPQRLTEEFELLQQRVDAMLIERLQQEQNAEIRGRIFRFP
AELARLKDRLHEALAELCASSPLIEAPLLRGVYFASGTQPETEKSPAASRTRRSYFLSRLFKDVIFPEAA
LVTRDKRLSRRQLLVRRIAYAVSATAVAIVFTGWIFTYFANTQALAEADRKLGAYEQLVQGIPVREVADA
DFLRILPALDNLRDVNSGFARERVWNVSFGLDQEDKIAGRQRDAYQRALNALLLPRMIVQLQKQLKDEKD
VTRTFNSLKLYGMLGGMGGLDRDFLTTQTHQMFASLYPGDGRAAAREALDQHAKALADGVLAPIELDARL
IATARETIRDQAIGTRAYDILAGLPQVRELMEWTPATAFGPLGERAFERRSKAPMAEGIEGLFTADGYRR
VVIPQVAHAARVALSEGWVRGSDDAIKGATVEQVAQAALQIYFDRFEKIWADTLSDLRVKPSQSLGDAVE
TTRALANERNIVVEAARSIAEATDLRPGANPAALASAAEGDATAAVLAATVNAADPYARLRDMLATKGAA
TTGEQPNGDKTGGSPSEQLLAHFKLLNEQLARSATTSDEVAKVFDVDSQLTKANQDLLQQARELPAPLDV
WVAGVAADVGSLAVKSARSRIAELWTADSASLCSSIVTGRYPFDRASSRDVAIADFTRLFAPTGVFQSFF
KQRMEPFVDKTTTPWSWKGTFGAAGIPSSAVAQFENADKISRAFFPNGSETPTVSINVKPVSLTNASSAV
MLEIEGERVVYYHGPIQAKSITWPSRENTASLSRIAFQPGGWQQAKTENGDWSPFRLFDGANIENQSGEL
LRVRFENGVQAAEFDIQFGSVLNPFKLDAIASFACPAQF
 
Nucleotide Sequence: 3480 bp     [Download]
>gi|159185562|ref|NC_003063.2|:c1464235-1460756 Agrobacterium tumefaciens str. C58 chromosome linear, complete sequence
ATGAATCCATTGAGCTATTTTTATACGATCCGTTCCTATGTCGAGAGCTATGCGGCCCTCGTCGGCCGGC
GTTTCCTCTCGCTTTTATGGGTGATCGCGCTCTGCGTCGTCGTCTGGTTCTACGGCTATCTGATCGCGCT
CGGCGATTTCAAACCGCTTGGAACGGTGCAGGCGCGGCTCATCGCCATCGGCATCATCGTCGCCGTCTGG
CTGGTCTACATCATCGTCACGATCTACCGCGGCCGCAAACAGGACAAGGAACTCGTCGACAGTATCGAGC
GCGAGGCGCTGGCCAATCGGCAGGCGGAAATCGGCGAAATCCAGACCCGCCTGAAAGAAGCGCTCGCGCT
CTTGCGGCGCGTCACGAAAAAGCGCTTCGGTTACATTTACGACTTGCCCTGGTACGTGATCTTCGGCGCA
CCCGGCTCCGGCAAGACGACGGCGCTGACCAATTCCGGCCTGCAATTTCCGCTTGGCGATGCGCTCGGTG
AAAATGCGGTGAAGGGTATCGGTGGCACGCGCAACTGTAACTGGTGGTTCGCGGACGAGGCGATCCTTAT
CGACACTGCCGGTCGCTATACCACCCAGGATGACCTCGACGGTTCCTCGAAGGCCGGCTGGGAAGGCTTT
CTTGGCCTTTTGAGGCGATATCGTCGTTCGCAGCCGATCAATGGCGCATTGGTCACGCTGTCCATTCCCG
ATCTGCTCAACCGCGATCCCGAAGAACAGCGGCAGGAGCTGCGCTCCATCCGCCAGCGTCTTTCGGAACT
TGACGAATATCTGCATGCCCGCGTTCCGGTCTATATCGTCCTGACGAAAGCCGACCTGCTGCATGGTTTC
GTGGAATTTTTCGATGGATTCAACAAGACCGACCGCCAGCAGGTGTGGGGCACCACCTTCAAGCTGGATG
AGAGCTACTCCGCCGAAAACCTGCCGCAGCGTCTGACGGAAGAATTCGAACTGCTACAGCAGCGGGTCGA
TGCCATGCTGATCGAACGCCTGCAGCAGGAGCAGAATGCGGAAATACGCGGCCGTATCTTCCGTTTTCCA
GCCGAACTCGCGCGGCTGAAAGATCGCCTGCACGAGGCCCTTGCCGAACTTTGCGCAAGTTCGCCTCTCA
TCGAGGCGCCGCTTCTGCGCGGCGTTTATTTCGCGTCGGGAACGCAGCCGGAAACGGAAAAATCTCCCGC
GGCATCCAGAACCCGCCGCAGCTATTTCCTGTCGCGGTTGTTCAAGGACGTCATCTTCCCTGAAGCCGCC
CTGGTGACGCGTGACAAGCGCCTTTCCCGGCGGCAATTGCTGGTGCGGCGCATTGCTTATGCCGTATCCG
CCACGGCGGTCGCCATCGTCTTCACCGGCTGGATTTTCACCTATTTCGCCAATACGCAGGCGCTGGCCGA
AGCGGATCGCAAACTTGGCGCTTATGAGCAGCTCGTTCAGGGAATTCCCGTGCGCGAGGTCGCGGACGCC
GATTTCCTGCGGATCCTCCCCGCGCTCGACAATCTGCGCGATGTCAATTCCGGCTTTGCCCGCGAACGCG
TGTGGAATGTCAGCTTCGGTCTTGATCAGGAAGACAAGATTGCCGGCCGGCAGCGTGACGCCTATCAGCG
CGCACTCAACGCCCTTCTGCTGCCGCGCATGATCGTGCAGCTGCAAAAGCAGCTGAAGGACGAAAAGGAT
GTCACCCGCACGTTCAATTCGCTGAAACTCTACGGAATGCTGGGCGGGATGGGTGGTCTGGACCGCGATT
TCCTGACCACGCAGACGCATCAGATGTTCGCATCCCTTTATCCCGGTGACGGAAGGGCGGCGGCGAGAGA
AGCGCTTGACCAGCATGCAAAGGCGCTCGCTGACGGCGTGCTCGCCCCGATCGAGCTCGATGCGCGGCTC
ATCGCCACCGCCCGCGAAACCATCCGCGATCAGGCGATTGGCACACGCGCCTATGATATTCTCGCCGGCC
TTCCGCAAGTGCGGGAATTGATGGAATGGACACCCGCTACGGCTTTCGGCCCGCTGGGGGAGCGTGCTTT
CGAGCGTCGCAGCAAAGCGCCGATGGCCGAGGGGATAGAGGGCCTTTTCACCGCCGATGGATATCGCCGC
GTTGTCATCCCGCAGGTCGCGCATGCGGCCCGCGTCGCGCTTTCCGAAGGATGGGTGCGCGGTTCTGACG
ATGCCATCAAGGGTGCGACTGTCGAGCAAGTGGCGCAGGCCGCGCTGCAAATCTATTTCGACAGGTTCGA
GAAAATATGGGCCGACACGCTGTCCGATCTGCGCGTCAAACCATCCCAGAGCCTCGGCGACGCGGTGGAG
ACAACACGGGCTCTTGCCAATGAGCGCAATATCGTGGTGGAGGCTGCCAGATCGATCGCAGAGGCGACCG
ATCTCCGCCCCGGAGCAAACCCCGCCGCCCTCGCCTCCGCTGCGGAAGGAGACGCAACCGCAGCCGTTCT
GGCCGCTACGGTGAATGCGGCCGATCCCTATGCGAGACTGCGCGACATGCTGGCGACGAAAGGCGCAGCT
ACAACGGGCGAGCAGCCCAATGGCGACAAGACCGGTGGTTCGCCATCGGAACAGTTACTCGCGCATTTCA
AGCTGCTGAACGAACAGCTTGCCCGTTCGGCAACCACCTCCGATGAGGTCGCCAAGGTGTTCGACGTGGA
CAGCCAGCTCACCAAGGCCAATCAGGATCTGTTGCAGCAGGCACGCGAATTGCCGGCACCGCTCGACGTC
TGGGTGGCAGGCGTGGCGGCGGATGTCGGCTCGCTCGCGGTCAAGTCCGCACGCAGCCGCATCGCCGAAC
TCTGGACGGCCGATTCAGCCTCCCTGTGCTCCTCGATCGTGACCGGTCGTTATCCCTTCGACCGAGCCTC
CTCCCGCGATGTCGCGATTGCGGATTTTACCCGTCTCTTCGCGCCGACGGGGGTTTTCCAGAGCTTCTTC
AAACAGCGCATGGAACCGTTTGTCGACAAGACGACGACCCCATGGAGCTGGAAAGGCACCTTCGGCGCCG
CCGGCATTCCCAGCAGCGCCGTCGCCCAGTTCGAAAATGCCGACAAGATTTCGCGCGCCTTTTTCCCGAA
TGGCAGCGAGACGCCGACGGTTTCGATCAATGTCAAACCCGTCTCGCTCACCAATGCCTCCAGCGCGGTG
ATGCTGGAAATCGAAGGCGAGCGGGTCGTTTATTATCATGGACCGATCCAGGCGAAATCGATTACCTGGC
CCTCGCGCGAAAACACGGCGAGCCTGTCGCGCATCGCCTTCCAGCCGGGCGGCTGGCAGCAGGCGAAGAC
CGAAAACGGCGACTGGTCGCCCTTCCGGCTGTTTGACGGTGCCAATATCGAAAATCAGTCGGGTGAGCTG
TTGCGGGTGCGGTTTGAGAATGGCGTCCAGGCTGCCGAGTTCGATATTCAGTTCGGCTCGGTTCTCAATC
CATTCAAGCTGGATGCGATTGCCAGCTTCGCCTGCCCTGCGCAGTTCTAG
 Primer design