SecReT6
Protein ID: 160899280
SecReT6 ID236
T6SS typei3
Gene symbol-
Locus tagDaci_3846
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T6SS(s) in this replicon]
Location [Strand]4239050..4242706 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDA9BLJ2
KEGG IDdac:Daci_3846
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.00E-97, Aligned region: 205..476
IcmF-related [PF06761], Evalue: 4.40E-93, Aligned region: 525..838
DUF1215 [PF06744], Evalue: 1.50E-33, Aligned region: 955..1078
DUF4381 [PF14316], Evalue: 0.0014, Aligned region: 45..94
DUF4381 [PF14316], Evalue: 0.0014, Aligned region: 472..534
DUF4381 [PF14316], Evalue: 0.0014, Aligned region: 545..623
DUF4381 [PF14316], Evalue: 0.0014, Aligned region: 793..831
AAA_16 [PF13191], Evalue: 0.0037, Aligned region: 140..267
AAA_16 [PF13191], Evalue: 0.0037, Aligned region: 657..657
Protein Sequence: 1218 a.a.     [Download]
>gi|160899280|ref|YP_001564862.1| type VI secretion protein IcmF [Delftia acidovorans SPH-1]
MIRRIASWLFNRYMLELLGLVALSLLIWFVGPLVFIQPYQPLGSPTVRWWIIAGLFILWFLRLLLRWWRA
QRMNEHLMTGLARLTSPREADGTPAAGSEEVAELESRFKEALDTLSKTRFGQTEGGLFGRWNKRYIYQLP
WYLIIGSPGSGKTTALINSGLDFPLAAQFGKRAIPGIGGTRNCDWWFTDQAVLLDTAGRYTTQESDAEQD
KAAWKGFMQLLKRFRGRQPVNGVIVTLSVQELLSASDAERAQLAQLIGLRLSELCEELTIRFPVYVLVTK
SDLLAGFNEFFGAMSREERAQVWGFTYPYDEKTQRSPASDPQAASALYMEEFDALVAQINRLLPQRLMTE
PDLARRSLLYALPQQFAGLKDVVRDTLDAAFSASRFKEKPLLRGVYFTSGTQEGMPFDRVMSALSRRFAL
RGRLPADAVPQQGRSYFLESLFKDVMFNESGLTGRNAKKERQLRLMQAAGLCALLLALGGAALAWTLSYE
NNQRYLNEVADNAGTLRQAVEESKATDPDNVVALVPMLNHAARVAQSSRFEESAPLGWRWGLLQVPKVQT
AAHATYLRLLEDAWLPRLSSHVARSLRQVSTGSPEASYETLKAYLMLYEPDHFDATFVKAWLRSDWENTL
PQHLVQAGLVDQLSEHLDRLIDGRVVVSAQPIDANLVAEVRQRLAQMSPAQRAYSRLKQLLNTGDKLPPD
FSVVRASGPEAPQVFARASGKPLTQGISGLFTYDGYHGLFLHELPKVTTLLAKEETWVLGQAEGRRSVAQ
EVLTGQLANEVKRLYLMEYARLWETFLADIRPIRTASLEQAGEQARLYSSANSSLEQFIRAVARETTLAR
RPDQQEGGGSGSTSSWLGEKLQRIREEQHQLSRLTGKPLNVGGMLATGTLEADIVDFRFREYRRLATSNG
SGPAPITASLQVLNEAAAVIASARQQVIQGGGVPPSLSGTLEKVRSEAKRVPPPLNSMYEALATSTSSFV
GSSVRSTLGGNLNATIGDFCRRAILGRYPFTRSATRDVTTDDFARLFATGGTMDEFFRTQLQTMVDISTV
PWTFKQGVDGTPVGGSASLAAFQRAASIRDVFFRAGGNTPGIRLEIKPLDMDASISQMVLDVDGEIVRYQ
HGPQIPKAVSWPGTRGTGQARLQITAAGAQNTGIVTEGPWALHRLFDRAQILPGNSPERFTAIFTIDGRK
LRMEVTTSSVLNPFRLKAMEEFECPDRL
 
Nucleotide Sequence: 3657 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4239050-4242706 Delftia acidovorans SPH-1 chromosome, complete genome
ATGATCCGTCGCATCGCCTCATGGCTGTTCAACCGCTACATGCTGGAGCTTCTGGGCCTGGTGGCCCTGA
GCCTGCTCATCTGGTTCGTCGGCCCGCTCGTCTTCATCCAGCCCTACCAGCCGCTGGGCAGCCCCACCGT
GCGCTGGTGGATCATCGCCGGCCTGTTCATCCTCTGGTTCCTGCGCCTGCTGCTGCGCTGGTGGCGCGCA
CAGCGCATGAACGAGCACCTCATGACCGGCCTGGCCCGCTTGACCTCGCCGCGCGAGGCGGACGGCACGC
CCGCAGCAGGCTCCGAGGAAGTGGCCGAGCTGGAGTCGCGCTTCAAGGAAGCCCTGGACACGCTGAGCAA
GACCCGCTTCGGCCAGACCGAAGGCGGCCTGTTCGGCCGCTGGAACAAGCGCTACATCTACCAGCTGCCC
TGGTACCTGATCATCGGCTCGCCGGGCTCGGGCAAGACCACGGCCCTGATCAACTCGGGGCTGGACTTCC
CGCTGGCGGCCCAGTTCGGCAAGCGCGCCATCCCCGGCATAGGCGGCACGCGCAACTGCGACTGGTGGTT
CACCGACCAGGCCGTGCTGCTGGACACGGCCGGCCGCTACACCACCCAGGAAAGCGATGCGGAGCAGGAC
AAGGCAGCCTGGAAGGGCTTCATGCAGCTGCTCAAGCGCTTTCGCGGACGCCAGCCCGTCAACGGCGTGA
TCGTCACGCTCAGCGTGCAGGAACTGCTCAGTGCCAGCGACGCCGAGCGCGCCCAGCTGGCCCAGCTGAT
CGGCCTGCGCCTGAGCGAGCTGTGCGAGGAGCTGACCATCCGCTTCCCCGTCTACGTGCTGGTCACCAAG
AGCGACCTGCTGGCGGGCTTCAACGAGTTCTTCGGGGCCATGAGCCGCGAGGAGCGCGCCCAGGTCTGGG
GCTTCACCTATCCCTATGACGAAAAGACCCAGCGCTCGCCCGCCAGCGACCCGCAGGCCGCCAGCGCCCT
GTACATGGAGGAGTTCGACGCACTGGTCGCCCAGATCAACCGCCTGCTGCCCCAGCGGCTGATGACCGAG
CCCGACCTTGCGCGCCGCAGCCTGCTCTACGCACTGCCCCAGCAGTTTGCCGGCCTCAAGGACGTGGTGC
GCGACACGCTGGATGCGGCGTTCTCCGCCTCGCGCTTCAAGGAAAAACCGTTGCTGCGCGGCGTCTACTT
CACCAGCGGCACGCAGGAGGGCATGCCCTTCGACCGCGTGATGTCGGCCCTGTCGCGCCGCTTTGCGCTG
CGTGGCCGCCTGCCGGCCGATGCCGTGCCGCAGCAGGGCCGCAGCTACTTCCTGGAGTCGCTGTTCAAGG
ACGTGATGTTCAACGAGTCCGGCCTGACCGGGCGCAACGCCAAGAAAGAGCGCCAGCTGCGCCTGATGCA
GGCCGCCGGCCTGTGCGCGCTGCTGCTGGCCCTGGGCGGCGCGGCCCTGGCCTGGACGCTGAGCTACGAG
AACAACCAGCGCTACCTGAACGAAGTGGCCGACAACGCCGGCACGCTGCGCCAGGCCGTGGAGGAATCCA
AGGCCACCGATCCCGACAACGTGGTCGCCCTGGTGCCCATGCTCAATCACGCGGCGCGCGTGGCGCAGAG
CAGCCGCTTCGAGGAATCGGCCCCGCTGGGCTGGCGCTGGGGCCTGCTGCAGGTGCCCAAGGTGCAGACG
GCCGCCCACGCCACCTACCTGCGCCTGCTGGAAGATGCCTGGCTGCCGCGCCTGAGCAGCCATGTCGCGC
GCTCGCTGCGCCAGGTCAGCACCGGCAGCCCCGAGGCCAGCTACGAAACGCTCAAGGCCTATCTCATGCT
CTACGAGCCCGACCACTTCGACGCCACCTTCGTCAAGGCCTGGCTGCGCAGCGACTGGGAAAACACCCTG
CCCCAGCATCTGGTGCAGGCTGGCCTGGTGGACCAGCTGTCCGAGCACCTGGACCGCCTCATCGACGGCC
GCGTGGTGGTCTCCGCCCAGCCCATCGACGCCAACCTGGTCGCCGAAGTGCGCCAGCGCCTGGCCCAGAT
GTCGCCCGCCCAGCGCGCCTACAGCCGCCTCAAGCAGCTGCTGAACACCGGCGACAAGCTGCCGCCCGAC
TTCAGCGTGGTGCGTGCCAGCGGGCCCGAGGCGCCCCAGGTCTTTGCGCGTGCCAGCGGCAAGCCGCTCA
CCCAGGGCATCAGCGGCCTGTTCACCTATGACGGCTACCACGGCCTCTTCCTGCACGAGCTGCCCAAGGT
CACCACCTTGCTGGCCAAGGAGGAAACCTGGGTGCTGGGCCAGGCCGAAGGCCGGCGCAGCGTGGCCCAG
GAAGTGCTCACGGGCCAGCTGGCCAACGAGGTCAAGCGCCTGTACCTCATGGAGTACGCGCGCCTGTGGG
AAACCTTCCTGGCCGACATCCGACCCATACGCACGGCCTCGCTGGAGCAGGCCGGCGAGCAGGCCCGCCT
GTACTCGTCCGCCAACTCCAGCCTGGAGCAGTTCATCCGCGCCGTGGCACGCGAGACCACGCTGGCCCGC
CGCCCGGACCAGCAGGAAGGCGGCGGCTCGGGCAGCACCAGCAGCTGGCTGGGCGAGAAGCTGCAGCGCA
TCCGCGAGGAACAGCACCAGCTCAGCCGCCTGACCGGCAAGCCGCTGAACGTGGGCGGCATGCTGGCCAC
CGGCACGCTGGAGGCCGACATCGTGGACTTCCGCTTCCGCGAATACCGGCGCCTTGCCACCAGCAACGGC
TCGGGCCCGGCGCCCATCACCGCCAGCCTGCAGGTGCTCAACGAGGCGGCGGCCGTCATCGCCTCGGCGC
GCCAGCAGGTGATCCAGGGCGGCGGCGTGCCTCCCTCGCTGAGCGGCACGCTGGAGAAGGTGCGCTCGGA
AGCCAAGCGCGTGCCGCCTCCGCTCAACAGCATGTACGAGGCCCTGGCCACGTCCACCTCGTCCTTCGTG
GGAAGCAGCGTGCGCAGCACGCTGGGCGGCAACCTCAACGCCACCATCGGCGACTTCTGCCGCCGGGCCA
TCCTGGGCCGCTACCCCTTCACGCGCAGCGCCACGCGCGACGTGACCACGGACGACTTCGCCCGCCTGTT
CGCCACCGGCGGCACCATGGACGAGTTCTTCCGCACCCAGCTGCAGACCATGGTGGACATCTCCACCGTG
CCCTGGACCTTCAAGCAGGGTGTGGACGGCACGCCGGTGGGGGGCTCTGCCTCGCTGGCCGCCTTCCAGC
GCGCGGCCTCCATCCGCGACGTGTTCTTCCGCGCAGGCGGCAACACGCCCGGCATCCGGCTGGAGATCAA
GCCGCTGGACATGGACGCCTCCATCTCCCAGATGGTGCTGGACGTGGACGGCGAAATCGTGCGCTACCAG
CACGGCCCGCAAATCCCCAAGGCCGTCTCCTGGCCGGGCACGCGCGGCACCGGCCAGGCCCGGCTGCAGA
TCACGGCCGCCGGCGCCCAGAACACCGGCATCGTGACCGAAGGCCCCTGGGCGCTGCACCGCCTGTTCGA
CCGTGCCCAGATCCTGCCGGGCAACTCGCCCGAGCGTTTCACGGCCATCTTCACCATCGACGGACGCAAG
CTGCGCATGGAAGTCACCACCAGCAGCGTCCTCAACCCATTCCGGCTCAAGGCCATGGAGGAATTCGAAT
GTCCGGACCGGCTGTGA
 Primer design