SecReT6
Protein ID: 161504499
SecReT6 ID237
T6SS typei2
Gene symbol-
Locus tagSARI_02612
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2532006..2535377 [-]
Producthypothetical protein
NoteTssM
UniProt IDA9MMZ4
KEGG IDses:SARI_02612
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.00E-74, Aligned region: 420..732
DUF1215 [PF06744], Evalue: 5.30E-35, Aligned region: 236..258
DUF1215 [PF06744], Evalue: 5.30E-35, Aligned region: 853..973
ImcF-related_N [PF14331], Evalue: 0.0003, Aligned region: 176..232
Protein Sequence: 1123 a.a.     [Download]
>gi|161504499|ref|YP_001571611.1| hypothetical protein SARI_02612 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MAKVKVKTLIGSVVTVAFFLTVIVAFLFYAFPENVASATGFGPYDGQRILTFCTILVAALFLFGWLIEKA
FDFAGRSGLYFHWGQKKAQMVVPATGTIASEDDEEEPVFSEDAVSEHLRFRYGRRWQRKVRLLLVMGNPD
DVQKAAPGLCHDLWQEGDGNVLIYGGDAQSLPDEIFLSKLKRLRSGQPVDGIIQVMSTSALPTDSERDAF
LRFRQKADHQLGWQAPVWLWLTDKAKGAQQDADTAATGVIFGPEGTIEEADKALTTLSQRLQKAGMAQIL
NNPAHNGLLQLSSRLQHELKARLTVLLSGLMQGSAAFRLRGVMFSPELAATGTVPNTRLDTPVWKAVIDD
CNAVSAKKLGYDWLKVLRLILLALIVLWGAGTQLSLIVNRTQIYQAQETARQAADTAKPLAERLHNQLVL
QQAIARLQHREATGAPWYTRFGLNQDSDTLAALWPLYAKNNAQLMRDATADYLRQQLNAFVQLPPASDAR
TQGTQHTYDVLKSYLMLARPDKADASWLAKNVLVAWPKRQNVPDGTWQEMAPKLLGFYAQNLPEHPEWKI
KSDAELISTVRQILLKQIGQRNAESGLYQDMLKRVASNWPDLTLADMTGDTDASTVFSTDEVVPGMFTRQ
AWEEQVQDAIDEVVKTRRDEIDWVLTDKTHQPGSDISPEALKARLTERYFTDFGNAWLNMVNSIQWQEAS
SLSEAIAQLNLIGDIRQSPLVALMNTLNYQGKTGQKGGLLADSIVDSAKKLIGQKKNARQFIEQTRGPEG
PLDGVFGPLMGLMEGKEGTGANGNLSFQSWLARVTQVRLKLQQVTSAPDPQAMSQMLAQTVFQGKAIDLT
DTRDYGSLFAASLGQEWNGFGQSLFVQPLDLAWRQVLAPAAGSLNARWQSTIVEQWNKAFAGRYPFKATG
SDASLPLLAQFLRSDSGRITTFLKTNLGGILHQEGNRWVVDPSASQGMVVSPDFLLAINQLAELSDIVFS
QGDAGVHFELMARPSRDVARVQLTLDEQNLDYFNQMESWQSFTWPGNTYYPGVSLSWRSVNSGMQLYANN
QGNWGFIRLLDKALITPLDASRTQLVWITADGNPLKFVMRSELGDGPLALLKLQGFTLPGSIFNVAAGTE
GVE
 
Nucleotide Sequence: 3372 bp     [Download]
>ref|NC_010067.1|:c2535377-2532006 hypothetical protein SARI_02612 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGGCTAAGGTAAAAGTAAAAACACTCATCGGCTCCGTTGTGACTGTCGCCTTTTTTCTGACGGTCATCG
TGGCATTTCTGTTTTATGCCTTTCCGGAAAACGTGGCTTCGGCCACCGGATTCGGTCCGTATGACGGCCA
GCGCATACTCACATTCTGCACCATACTGGTTGCCGCGTTGTTTTTATTCGGCTGGCTGATTGAGAAGGCC
TTCGACTTCGCCGGTAGATCGGGGCTGTATTTCCACTGGGGTCAGAAAAAGGCTCAGATGGTCGTCCCGG
CAACAGGCACCATTGCGAGCGAAGATGATGAAGAAGAGCCTGTCTTCAGTGAGGATGCCGTATCCGAGCA
CCTCCGTTTCCGCTATGGCCGTCGCTGGCAGCGTAAAGTGCGACTCCTGCTGGTGATGGGTAATCCGGAC
GACGTCCAGAAAGCAGCCCCGGGTCTGTGCCATGACCTCTGGCAGGAAGGTGACGGCAACGTACTGATTT
ATGGCGGTGATGCGCAGTCACTTCCGGATGAGATCTTCCTTTCAAAACTGAAACGCCTGCGATCAGGCCA
GCCGGTTGATGGAATTATTCAGGTGATGAGTACTTCAGCCCTCCCGACGGATAGCGAACGGGATGCTTTC
TTGCGTTTCCGCCAGAAAGCCGATCATCAGCTGGGCTGGCAGGCGCCTGTCTGGCTGTGGCTGACTGATA
AAGCCAAAGGTGCTCAGCAGGACGCGGACACGGCTGCGACAGGGGTGATATTCGGACCGGAAGGCACTAT
AGAAGAGGCGGATAAGGCATTGACTACGCTGTCTCAGCGCCTGCAAAAAGCCGGTATGGCACAGATACTG
AATAATCCGGCTCATAACGGCCTGCTCCAGTTATCTTCCCGTCTGCAGCACGAACTGAAAGCCCGTCTGA
CCGTTTTGCTCAGCGGGCTGATGCAGGGATCTGCGGCCTTTCGTTTACGGGGGGTTATGTTCAGTCCTGA
ACTGGCCGCTACCGGAACGGTGCCGAACACGCGCCTCGACACACCGGTGTGGAAAGCCGTCATTGATGAC
TGTAATGCCGTCAGCGCAAAAAAACTGGGCTATGACTGGCTGAAAGTGCTACGGCTCATCCTGCTTGCTC
TGATTGTGTTATGGGGTGCAGGTACTCAGCTGTCACTCATCGTTAACCGTACCCAGATTTATCAGGCACA
GGAAACGGCGAGGCAGGCAGCGGATACCGCAAAACCACTTGCTGAACGCCTGCACAACCAGCTCGTACTC
CAGCAAGCTATTGCCCGTCTGCAACATCGTGAGGCGACCGGCGCCCCATGGTACACGCGTTTTGGTCTTA
ATCAGGACAGTGACACGCTGGCTGCTCTCTGGCCGCTGTATGCGAAAAACAACGCACAGCTGATGAGGGA
TGCCACCGCAGATTATCTCAGGCAGCAGCTGAATGCGTTTGTGCAACTCCCTCCTGCCAGTGATGCCCGT
ACGCAGGGTACACAGCACACCTATGACGTGCTCAAAAGTTATCTGATGCTGGCCCGTCCGGATAAAGCGG
ACGCGAGCTGGCTGGCAAAAAACGTACTGGTAGCCTGGCCGAAGCGTCAGAATGTGCCGGATGGCACATG
GCAGGAAATGGCGCCGAAACTACTGGGTTTTTATGCGCAGAACCTCCCGGAACATCCGGAATGGAAAATT
AAGTCCGATGCTGAACTCATCAGTACGGTACGTCAGATCCTGCTCAAACAGATAGGCCAGCGTAACGCCG
AATCCGGGTTGTACCAGGACATGCTTAAGCGCGTTGCCAGTAACTGGCCTGATTTAACGCTGGCGGACAT
GACCGGTGATACCGATGCCTCAACGGTATTCAGCACTGACGAAGTCGTTCCGGGAATGTTTACACGCCAA
GCCTGGGAAGAGCAGGTTCAGGATGCAATTGATGAGGTGGTCAAAACCCGGCGTGACGAAATCGACTGGG
TTCTGACGGATAAAACCCATCAGCCCGGGAGTGATATTTCCCCGGAAGCGCTGAAGGCCCGTCTGACAGA
ACGCTATTTTACCGATTTTGGTAACGCCTGGCTGAACATGGTCAACAGCATTCAGTGGCAGGAAGCTTCG
TCACTTTCTGAGGCGATTGCCCAGCTTAATCTGATCGGTGATATCCGCCAGTCGCCTCTGGTTGCACTAA
TGAACACGCTAAACTACCAGGGAAAAACCGGACAGAAGGGCGGGCTACTTGCCGACTCGATAGTGGATTC
AGCGAAAAAGCTGATCGGTCAGAAAAAAAATGCCAGACAGTTTATAGAGCAGACCCGGGGGCCTGAAGGC
CCGCTTGATGGGGTGTTTGGTCCGCTAATGGGGCTGATGGAAGGGAAAGAGGGTACAGGTGCTAACGGTA
ACCTTAGCTTCCAGTCCTGGCTTGCCCGCGTTACCCAGGTGCGGCTGAAGCTTCAGCAGGTCACCAGCGC
ACCGGATCCGCAGGCTATGTCGCAGATGCTGGCCCAGACCGTGTTCCAGGGCAAAGCCATCGACTTGACC
GACACCCGCGATTACGGCAGTCTGTTTGCGGCAAGCCTGGGCCAGGAATGGAACGGATTTGGACAGTCAT
TGTTCGTACAACCGTTAGATCTGGCGTGGAGACAGGTTCTGGCTCCGGCAGCGGGAAGCCTGAATGCACG
CTGGCAGTCGACCATTGTCGAGCAGTGGAATAAGGCCTTTGCGGGACGGTACCCGTTTAAAGCCACCGGT
AGCGATGCTTCCCTGCCGCTACTGGCTCAGTTCCTGCGTAGCGACTCGGGTCGAATCACTACCTTCCTGA
AAACGAATCTCGGCGGGATCCTCCACCAGGAAGGGAATCGCTGGGTCGTTGATCCTTCCGCAAGTCAGGG
GATGGTTGTCAGTCCGGATTTTCTCCTGGCGATTAATCAGCTGGCGGAACTCTCAGATATCGTGTTCTCT
CAGGGCGATGCAGGTGTTCACTTCGAGTTGATGGCGCGTCCTTCACGGGATGTTGCCAGAGTGCAGCTTA
CCCTCGATGAGCAGAACCTGGATTACTTCAATCAGATGGAAAGCTGGCAGAGCTTCACCTGGCCGGGGAA
TACGTACTATCCGGGCGTGTCACTCAGCTGGCGAAGTGTCAACAGCGGTATGCAGCTCTATGCAAACAAC
CAGGGTAACTGGGGTTTCATTCGCCTGCTGGACAAAGCCCTGATCACTCCACTCGATGCCAGCCGTACAC
AGCTGGTGTGGATCACCGCCGATGGCAATCCTCTGAAGTTTGTGATGCGCAGCGAGCTCGGCGACGGTCC
GCTTGCCTTACTGAAGCTACAGGGATTTACGCTACCAGGGTCCATTTTTAACGTTGCCGCTGGCACCGAA
GGCGTTGAGTAA
 Primer design