SecReT6
Protein ID: 161504606
SecReT6 ID238
T6SS typei2
Gene symbol-
Locus tagSARI_02720
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2628598..2632005 [-]
Producthypothetical protein
NoteTssM
UniProt IDA9MNU4
KEGG IDses:SARI_02720
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 9.80E-73, Aligned region: 418..738
IcmF-related [PF06761], Evalue: 9.80E-73, Aligned region: 800..817
DUF1215 [PF06744], Evalue: 5.10E-36, Aligned region: 633..650
DUF1215 [PF06744], Evalue: 5.10E-36, Aligned region: 857..976
Protein Sequence: 1135 a.a.     [Download]
>gi|161504606|ref|YP_001571718.1| hypothetical protein SARI_02720 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MAKDSSAWRGSWGGLGFTAIIAAILAWAIWSHGDAIGLNSEGLKTLGIVGAMILLLLIRHGRAIGLALKQ
RWSRFQAERKKELPTSEGRVEQTLPRNVTVDTIREAMRNLYGRRWGRKTRILLITGTAAEVEQLTPGLTT
QLWQEDRGTLLLWGGDLNTPPDSAWLTALRKLRRRPVDGLVWVTSAFDQLSAPGLAPPLPVPSESTMDSL
SHAISARMEALGWQTPLYVWSLHPRAGKPEGRVVQATGCLLPAGCLTEGLAEQLSALTPDLTSLGLQQTC
GEVKHNFLLTLADQLIREPQSVTTPLSVMLNPYRPLPLAGVVFSQPSAGAERAVAHHWGMDKRWDVLPES
VRTLAAGLRPRKPGIPWRKVFVSVAALAMVGWAVWMGIAYVTNRSQIDGANVQASTAARQNQPLAQRLHA
LSELQKTLARLQYRSEHGVPWYERAGLSQNNALLAALWPRYQDSALPLLRDASANHLQRQINAFNALPPD
SPLREQMAKNTYDQLKLYLMLARPEHMDAAWFSSALQHDWPKRDGVKDGVWQGVAPSLLSFYGAQLVTHP
EWKLRADENMVSQARSLLVRLMGVRNSESTLYQKMLAQVAHLYADMRLEDMTGDTDASRLFSTPEIVPGM
FTRQAWEQAVQPAIEKVVKARRDELDWVLTDSKRQVNKQDETSPEALKKRLTERYFADFGGAWLEFLNSL
HWNQAATLSDSIDQLTLMADVRQSPLVALMNTLNAQGRTGQTGEAISDSLVKSAKNLLGGDNKDAIDQSV
GVHGPLDAAFGPVLALVDKNRTGAQELSLQSYLTRVTQVRLRLQQVTNAADPQAMTQTIAQTVFQGKAVD
LTETRDYGSLIAAGLGQEWSGFGRTMFVNPMEQAWQQVLTPAADSLNAQWQQAVVSEWNSAFGGRYPFSN
SSSDVSLPLLAKYLNADSGRIAQFLQNRLKGVLHKEGNHWVPDSINSQGLAFSPAFLNAINTLSYISDVA
FTEGNAGVNFELRPGTADGVMQTDIIIDSQKLTYVNQLPAWKRFTWPADTEAPGANLSWISTQASTRQYA
DIPGSWGLIRLLDKARVKAYPGVGSSYSLSWKAQDGRTLNYTLRTEAGEGPLVLLKLRNFRLPETIFSTT
GVAVVSAASDAEEVY
 
Nucleotide Sequence: 3408 bp     [Download]
>ref|NC_010067.1|:c2632005-2628598 hypothetical protein SARI_02720 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGGCAAAGGATAGTTCAGCGTGGCGTGGTAGTTGGGGAGGTCTCGGCTTTACCGCGATAATCGCTGCTA
TACTGGCATGGGCCATCTGGTCGCATGGGGATGCAATTGGCCTGAACAGCGAAGGATTAAAAACATTGGG
TATTGTCGGGGCGATGATCCTGTTGTTGTTAATTCGTCATGGCAGGGCTATCGGATTAGCGCTCAAACAA
CGCTGGTCACGTTTTCAGGCTGAACGTAAGAAAGAACTGCCAACCAGTGAAGGTCGCGTTGAGCAGACCC
TGCCGCGCAACGTCACGGTCGACACCATCCGTGAAGCCATGCGTAACCTCTACGGTCGGCGCTGGGGGCG
TAAAACTCGCATCCTGCTGATAACCGGTACGGCCGCTGAAGTGGAGCAACTGACTCCGGGCCTTACAACT
CAGCTCTGGCAGGAAGACCGCGGCACACTGTTGCTGTGGGGCGGTGACCTCAATACGCCACCGGACAGTG
CCTGGCTGACCGCGCTGCGCAAACTGCGCCGTCGCCCGGTAGATGGGCTGGTGTGGGTCACCTCGGCCTT
TGACCAGCTCTCAGCACCAGGGCTGGCGCCGCCGCTGCCGGTACCGTCTGAAAGCACCATGGATTCCCTG
TCTCACGCCATCAGCGCACGTATGGAAGCGCTTGGCTGGCAGACCCCGCTATATGTCTGGTCCCTGCACC
CGCGAGCTGGTAAGCCGGAAGGACGGGTTGTACAGGCGACCGGCTGTCTGTTGCCTGCCGGTTGTCTCAC
CGAAGGGCTGGCAGAGCAACTCTCCGCCCTGACGCCAGATCTGACCTCACTGGGCCTGCAGCAGACCTGC
GGTGAAGTGAAACATAACTTCTTACTGACGCTTGCCGACCAGCTCATTCGTGAGCCACAGAGCGTGACCA
CACCGCTGTCGGTGATGCTCAATCCGTACCGCCCGCTGCCGCTGGCCGGTGTGGTGTTCAGTCAGCCCTC
CGCCGGCGCTGAACGTGCCGTGGCGCACCACTGGGGCATGGATAAACGCTGGGATGTTTTACCTGAGTCT
GTCCGCACGCTTGCTGCCGGGCTGCGCCCGCGCAAGCCGGGCATTCCATGGCGTAAAGTGTTTGTGTCAG
TCGCTGCCCTGGCGATGGTGGGCTGGGCTGTGTGGATGGGCATCGCGTATGTCACTAACCGCAGCCAGAT
AGATGGCGCTAATGTACAGGCCTCGACGGCTGCCCGACAGAATCAGCCCCTGGCGCAGCGTCTGCATGCA
CTGTCTGAACTCCAGAAAACCCTGGCTCGTTTGCAATACCGTTCAGAGCATGGCGTGCCGTGGTACGAAC
GGGCCGGGCTGAGTCAGAATAACGCCCTGCTAGCCGCACTCTGGCCACGCTATCAGGACAGCGCACTGCC
GCTGTTGCGGGATGCTTCTGCAAACCATCTGCAAAGACAGATTAATGCCTTTAATGCACTGCCGCCGGAC
AGCCCGCTGCGTGAGCAAATGGCAAAAAACACCTATGACCAGCTTAAGCTCTACCTGATGCTGGCGCGCC
CGGAACACATGGACGCCGCCTGGTTCAGTTCTGCGCTGCAGCACGACTGGCCAAAGCGTGATGGCGTGAA
AGACGGCGTCTGGCAGGGCGTGGCCCCGTCGCTACTGTCGTTTTATGGCGCACAGTTGGTGACGCATCCT
GAGTGGAAGCTCCGTGCCGATGAAAACATGGTCAGCCAGGCGCGCTCCCTGCTGGTTCGCCTGATGGGCG
TACGTAACAGTGAATCAACCCTGTACCAGAAGATGCTCGCTCAGGTGGCGCACCTGTATGCCGATATGCG
TCTCGAAGATATGACCGGGGATACTGATGCATCCCGTCTGTTCAGCACCCCCGAAATCGTACCAGGTATG
TTTACCCGCCAGGCCTGGGAGCAGGCCGTTCAGCCCGCCATCGAAAAGGTGGTGAAGGCGCGCCGGGACG
AGCTTGACTGGGTGCTGACTGACAGCAAGCGTCAGGTGAATAAACAGGATGAGACCTCGCCGGAAGCGCT
GAAAAAACGTCTGACGGAGCGTTACTTCGCCGATTTTGGCGGTGCCTGGCTTGAGTTCCTCAACAGCCTG
CACTGGAACCAGGCCGCTACGCTGTCGGATTCCATTGACCAGTTGACCCTGATGGCCGATGTGCGTCAGT
CACCTCTGGTGGCGCTGATGAACACCCTGAACGCGCAGGGACGTACCGGACAGACCGGCGAGGCGATTTC
GGATTCACTGGTGAAATCAGCGAAAAATCTGCTGGGTGGTGACAACAAGGATGCCATTGACCAGAGCGTC
GGTGTTCATGGTCCGCTGGATGCGGCCTTTGGCCCGGTGCTGGCGCTGGTGGACAAAAACCGCACAGGGG
CACAGGAACTGAGTCTGCAGTCCTATCTGACCCGTGTGACACAGGTGCGTCTGCGCCTGCAGCAGGTGAC
CAATGCCGCTGACCCGCAGGCGATGACCCAGACCATCGCTCAGACCGTATTCCAGGGTAAAGCCGTTGAC
CTGACCGAAACCCGCGACTACGGCAGTTTGATTGCAGCAGGCCTGGGTCAGGAATGGAGCGGTTTTGGTC
GTACGATGTTTGTGAACCCGATGGAGCAGGCCTGGCAGCAGGTTCTGACCCCGGCCGCCGACAGCCTCAA
CGCCCAGTGGCAGCAGGCAGTGGTGAGTGAATGGAACTCCGCCTTTGGCGGGCGCTATCCGTTCAGCAAC
TCCAGCAGCGATGTGTCCCTGCCACTGCTGGCCAAATACCTCAATGCGGATTCCGGACGTATCGCTCAGT
TCCTGCAGAACCGCCTCAAGGGCGTGCTGCATAAAGAGGGCAACCACTGGGTACCGGACAGTATCAACTC
GCAGGGGCTGGCGTTTAGCCCGGCATTCCTTAACGCCATCAACACCCTGAGCTATATCTCGGATGTGGCC
TTCACCGAAGGCAATGCTGGCGTAAACTTCGAGCTGCGTCCGGGTACCGCCGACGGCGTGATGCAGACCG
ACATAATTATCGACAGCCAGAAACTGACCTATGTGAACCAGCTTCCGGCGTGGAAGCGCTTCACCTGGCC
TGCGGATACTGAAGCGCCGGGCGCGAACCTGAGCTGGATTAGCACGCAGGCAAGCACCCGCCAGTACGCG
GATATTCCGGGCAGTTGGGGCCTCATACGCCTGCTTGATAAAGCGAGGGTGAAGGCGTATCCGGGCGTCG
GCAGCAGTTACAGCCTGAGCTGGAAAGCCCAGGATGGTCGCACACTCAATTACACCCTGCGAACCGAAGC
GGGAGAGGGACCTCTGGTATTGCTGAAACTGAGGAATTTCCGCCTGCCTGAGACCATCTTCAGCACTACC
GGCGTCGCAGTCGTCAGTGCAGCCAGTGATGCAGAGGAGGTCTACTGA
 Primer design