SecReT6
Protein ID: 161519726
SecReT6 ID240
T6SS typeN/A
Gene symbol-
Locus tagBmul_3177
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010086] [Browse all T6SS(s) in this replicon]
Location [Strand]21845..23809 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDA9AKU7
KEGG IDbmu:Bmul_3177
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-191, Aligned region: 34..652
Protein Sequence: 654 a.a.     [Download]
>gi|161519726|ref|YP_001583153.1| type VI secretion protein [Burkholderia multivorans ATCC 17616]
MRWSLRLAFDTLPTAMPSNAWRGTRIARAMNPHLLDAYNRELLYFKELVEEFAQAHPKIARRLGLHAGEI
ADPFVERLVQAASFTTARLQLKLDAAFPLLSSRLLETVYPNYVAPTPSIAVARLYPDEQEGNLLEGFRVP
RGTTFTSRVPDGERTPCTFRSGLDVTLYPLEIVSARLTGVPPDIPSVERYGAADRPIRGALRLRLRTTGE
ARFDELRGLDRLPVYLAGDERVASRLFELIHAGAVASVIGMPNRFADSNRSFGVVRDRAVEHTGLAADEG
LLPLVGTKFHGQNLLHEYATCPARFWFFTLTGLNAGLRYVTDREAEIVVLLDRFDGSLVEHVDASRFALF
CTPVINLFRRTSDPAEMPGTGAEVLVQPDRQNGSDYEVFAVEALHGFVSKGAASLEFRPLYRPLLNNEAD
HGRYFTIRREHGTAKTSYRRYGARTPYVSTDVFVSLVDENERSYPQAMKYLSVDAWLTNGDLPSLLEPEG
ATDLTVEISAPVRRTELVRAPSAARAPLAQGDAAWRLIGQLNLDYGRLETQDGSALRDILILFAAADDVR
LRRQIDSLIRVETRPVTKKLPGQGPLRFGRGIECVLTVDEAGFDGASPFLFGVILEHYVARHVSTHSFTQ
SVLRSPQRGELMRWPVRMGTRSAA
 
Nucleotide Sequence: 1965 bp     [Download]
>gi|161519706|ref|NC_010086.1|:21845-23809 Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence
TTGAGATGGTCTTTGCGGCTAGCATTCGACACATTGCCGACAGCGATGCCGTCGAACGCTTGGCGTGGAA
CCCGGATTGCGCGTGCCATGAATCCTCATCTGCTTGATGCCTACAATCGAGAACTGCTCTATTTCAAGGA
GCTGGTGGAGGAATTCGCGCAGGCGCATCCGAAGATTGCGCGTCGGCTGGGCCTGCATGCCGGCGAGATT
GCCGATCCCTTTGTCGAGCGGCTGGTGCAAGCCGCGAGTTTCACGACGGCTCGGCTGCAATTGAAACTGG
ATGCCGCATTCCCGTTGCTGAGCAGTCGGCTGCTCGAAACCGTCTATCCGAACTACGTCGCCCCAACGCC
ATCGATCGCGGTAGCGCGTCTCTATCCCGACGAACAGGAAGGCAATTTGCTCGAGGGTTTTCGAGTCCCT
CGCGGCACGACGTTCACGAGCCGCGTGCCCGATGGCGAGCGCACGCCCTGCACGTTTCGCAGCGGTCTCG
ATGTGACGTTGTATCCGTTGGAGATTGTTTCGGCGCGGTTGACCGGCGTGCCGCCTGACATTCCATCGGT
AGAGCGCTATGGCGCAGCCGACCGCCCGATTCGCGGCGCATTGCGTCTCAGGCTCCGTACCACAGGCGAA
GCGCGCTTCGACGAACTGCGCGGTCTCGATCGGTTGCCCGTCTACCTGGCCGGCGACGAGCGCGTCGCAT
CGCGGCTGTTCGAGCTGATCCACGCTGGCGCCGTGGCGTCCGTGATCGGGATGCCGAATCGTTTCGCCGA
TTCGAATCGATCATTCGGCGTTGTCCGCGATCGCGCCGTCGAACATACGGGGCTGGCTGCGGACGAGGGC
TTGCTGCCGCTGGTCGGGACGAAGTTTCATGGCCAAAACCTGCTGCACGAATATGCGACGTGTCCCGCGC
GCTTCTGGTTTTTCACGCTGACCGGTCTGAATGCGGGATTGCGATATGTGACCGATCGCGAAGCGGAAAT
CGTCGTGTTGCTGGATCGATTCGACGGTTCGCTGGTCGAGCACGTCGATGCTTCCCGCTTCGCCCTCTTC
TGTACACCGGTCATCAACCTGTTTCGCCGCACGAGCGATCCCGCCGAGATGCCGGGCACGGGCGCCGAAG
TTCTCGTGCAGCCCGACAGGCAGAACGGCTCGGATTACGAGGTGTTCGCGGTGGAGGCGTTGCATGGCTT
CGTCAGCAAAGGAGCGGCATCGCTCGAGTTTCGGCCGCTGTACAGGCCGCTGCTGAACAATGAAGCCGAT
CACGGGCGCTATTTCACGATTCGCCGCGAGCACGGAACGGCGAAGACGTCATACCGTCGCTACGGCGCTC
GTACGCCATACGTGAGTACCGATGTGTTCGTTTCGCTGGTCGATGAAAATGAGCGATCCTATCCACAGGC
CATGAAATACCTGTCGGTCGATGCGTGGTTGACGAACGGCGATCTGCCGAGCTTGCTGGAGCCCGAGGGC
GCGACCGATCTGACCGTCGAAATCAGCGCGCCCGTCAGGCGAACGGAACTCGTTCGTGCGCCGAGCGCTG
CACGTGCGCCGCTTGCACAGGGAGACGCGGCATGGCGGCTGATCGGTCAGTTGAACCTCGACTACGGCAG
GCTGGAGACTCAGGACGGAAGCGCGCTACGCGACATTCTGATTTTGTTCGCCGCTGCCGACGACGTGCGT
TTGCGTCGACAGATCGACAGCCTGATCCGTGTCGAGACGCGTCCCGTGACGAAGAAACTGCCCGGCCAGG
GCCCGTTGCGGTTCGGTCGAGGCATCGAGTGCGTGCTGACCGTGGACGAGGCCGGCTTTGACGGCGCGAG
CCCTTTTCTATTTGGCGTGATTCTCGAGCACTACGTCGCTCGTCACGTTTCGACACATTCTTTTACTCAG
TCCGTGCTGCGCTCGCCGCAGCGCGGCGAGCTGATGCGCTGGCCGGTTCGGATGGGGACGCGCAGCGCAG
CCTGA
 Primer design