SecReT6
Protein ID: 161519727
SecReT6 ID240
T6SS typeN/A
Gene symbol-
Locus tagBmul_3178
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010086] [Browse all T6SS(s) in this replicon]
Location [Strand]23880..29825 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDA9AKU8
KEGG IDbmu:Bmul_3178
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.00E-76, Aligned region: 35..361
Phage_GPD [PF05954], Evalue: 3.00E-76, Aligned region: 980..1014
Phage_GPD [PF05954], Evalue: 3.00E-76, Aligned region: 1175..1212
Phage_GPD [PF05954], Evalue: 3.00E-76, Aligned region: 1647..1679
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 885..910
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 900..929
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 947..983
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 1026..1045
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 1054..1079
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 1085..1120
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 1126..1161
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 1167..1203
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 1230..1267
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 1251..1288
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 1272..1308
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 1293..1326
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 1338..1368
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 1380..1393
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 1450..1460
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 1502..1532
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 1528..1551
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 1568..1598
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 1641..1661
RHS_repeat [PF05593], Evalue: 8.70E-72, Aligned region: 1646..1682
Phage_base_V [PF04717], Evalue: 1.90E-21, Aligned region: 400..493
RHS [PF03527], Evalue: 9.20E-10, Aligned region: 1084..1100
RHS [PF03527], Evalue: 9.20E-10, Aligned region: 1110..1137
RHS [PF03527], Evalue: 9.20E-10, Aligned region: 1223..1237
RHS [PF03527], Evalue: 9.20E-10, Aligned region: 1328..1347
RHS [PF03527], Evalue: 9.20E-10, Aligned region: 1735..1767
Protein Sequence: 1981 a.a.     [Download]
>gi|161519727|ref|YP_001583154.1| ImpA family type VI secretion-associated protein [Burkholderia multivorans ATCC 17616]
MVNFKTNRTFSVSGPALPDLEGIGAMLHLSAMRGTEQLSTPYTYELWLTTPADPRLPAEMLANLDLKAML
GKELTVTIQLDGMGSFVAGMAGQAGAGNLGAGTREISGIVTAASYVDQLNRQCRYRVVLEPWLALARERT
DYRIFQRKSVLDILREVFGSYWYSFEMRVGRTYRTLRYQVQYGESDFAFAQRLMEEHGIAWFFEHSQGVH
RLVLVDGPGAYRSVESVAYQTLEYYPPGRKIDREHVDRFEATERLQSGVWTTDDFDFEKPGATLTAQNSL
PRETAHNQLERYEWPGDYTETEDGHAFAQVRMEEIHAQGARAQGEGNLRNVVCGTTFVLAGHPMASANRE
YLVIASELDVKETGETTGFSAYAIRSRFTVQPSDVVFRPPRTIRKPRTRGPQTAIVTGPPDAEIWTNKNG
EVTLKFHWDRSDVKDQNSSCWVRVSYPWAGSNFGGIHVPRVGTEVIVDFENGDPDRPIVTGRVYNAMTMP
PWRLPAHATQSGILTRSTKGGGYGNANAIRFEDKKGAEQVWIQAERNLDAVIEADETHTVGHDRTKRIGH
DETDQIGRHWTLSTGGYKFETVTLASVKSVGMGAMFNVGMAYNVNVGGLYLRNVGLQMASTVGRSRTDRV
VQDWTADVGHTYTLTVRGKAVGDAVAADRANPIEPSPDFAPQLPAPVSSSNANQLRIADTGESSLSGAKQ
TQLIGPGGTVTIDESGIHLKGTAIYLQAPTISMTNGNAGGLAPVTEADCAECAKKSVSANPVDLATGQKV
LSHTDFTLPGRVSIDWSRSYRSADQRRGSLGVAWKLPYATEVRTSATGLIYFDADGRQLQFPALNPGEAH
FHPIEKFTLMRGDDNASGATYALRFGNGVEEHYGRHPVDETRWQLQRIATRDGQCLTLGYTAQGWLETVR
NNVHTVRCALDDAGRITSVLLDQGVGNQPLHLTSYVYDEHGDLVEATDRENLTWRYGYDNHLLTTYRTPA
GATHVSEWSDDTPNAYCLRTYAYTEGADGQRVVTREMRFDYLPSLRATRVTDGLGHTTEYHYNGLWAVEK
IVHPDGSVEQTHFDETGSVAGYTDALGRTTRIVNDARGNPTSIIDPAGNVTRISYGEHNLPEQITDPAGQ
IWQRGYDAHGHLTSETDPLGNVTRYAYENGLPVARTDALGNVTKMQWDDAGQLVARTDCSGHTTTYDYDP
FGQLTETTDALGQVSHHSGSVSARVTAVQPAGMGWWKVEYDEAGRAIAHTDPLERVTRVDWDGYGQRTQI
VDPAGGTQQFRYDAIGRLTKLTNANQETTTFRYDSRNRLIEQTGFDGRRQSYRYNAAGELVERIDHGQDG
QIATHVTYDVLGRPVERRSSDGSQASYRYDERGLLTQAQAIVPGRAPVHVTYEYDAAGRRTAEVQAHHGR
VWRLTHGVDAIGNRDWTHVPDIGSLVWQRYGSGHVHGILLDEHPLASFERDALHREIRRTQGPASHHFGY
GANGLLAVHRWQNLDERGRSLEHPRPWRAWAYDDAGQLTTLDDAWRDQKAYRYDALSRLTQVMAASGPEA
FHYDPAGNLLAAAPSRDNMQAWKASGDRLLRFAPQTRPDRPVDFTYDGHGNRIARTVPLPPKPALTEAEK
RSQRGTDNLLRVMEVLTGTPKYEEPSEVPEVTRYRYDGSHQLIAIEHADGARSEYEYDALGRRVAKHHTP
AGGAQQTTLFMWDGDWMMQEVRTGRTSHEDRAVTYVPHPDHEGPLTRLADGQAWHYVTDHLGTPQELYDE
QREVLWAADLSAYGRTARWLTRVVDNPIRFPGQYRDEESGLHYNRFRYYDPMVGRYINQDPIAFDGGINF
YSYADSAPNIAYDPKGLFVPLIAVASFLGRGALGGAVEIAMQGAKQVFRQAKNNWVDGRPLTDIDWDCVK
IDWTDVGVSVAVGGVAPSLGATRKSVTRSIKAIRNLSNQSANTANRAAKLKVRVDIKKDSIKRDLIVQGA
WQGIKQGAKCAFGEEKKCEEE
 
Nucleotide Sequence: 5946 bp     [Download]
>gi|161519706|ref|NC_010086.1|:23880-29825 Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence
ATGGTGAATTTCAAGACGAACCGGACCTTCTCGGTCAGCGGCCCGGCGCTACCGGACCTCGAAGGCATCG
GCGCGATGCTGCACCTGAGCGCGATGCGGGGCACGGAACAGCTTTCCACGCCGTACACGTACGAACTCTG
GCTGACGACGCCCGCCGATCCGCGACTGCCGGCCGAGATGCTGGCCAACCTCGATCTCAAGGCGATGCTC
GGCAAGGAACTGACCGTCACGATCCAGCTGGACGGGATGGGCAGCTTTGTCGCGGGGATGGCCGGCCAGG
CGGGCGCGGGGAACCTGGGCGCCGGTACGCGAGAAATCAGCGGCATCGTGACGGCGGCCAGCTACGTGGA
TCAACTGAATCGCCAGTGCCGTTATCGCGTCGTACTGGAGCCCTGGCTGGCACTGGCGCGCGAGCGGACC
GACTATCGCATCTTCCAAAGGAAGAGCGTGCTCGACATTCTGCGCGAGGTGTTCGGTTCGTATTGGTATT
CGTTCGAGATGCGCGTCGGCCGCACCTACAGAACGCTGCGCTATCAGGTCCAGTACGGCGAATCGGACTT
CGCGTTTGCCCAGCGCTTGATGGAGGAACACGGCATCGCGTGGTTCTTCGAACACTCGCAAGGCGTACAC
CGCCTGGTGCTGGTCGACGGTCCGGGCGCCTATCGGAGCGTGGAAAGTGTCGCGTATCAGACGCTCGAGT
ACTACCCGCCGGGCCGGAAGATCGACCGCGAGCACGTCGATCGCTTCGAGGCGACGGAGCGTCTGCAATC
GGGCGTCTGGACCACCGACGATTTCGATTTCGAGAAGCCGGGTGCGACGCTGACCGCGCAGAACAGCTTG
CCGCGCGAGACGGCGCACAACCAGCTCGAACGTTACGAATGGCCCGGCGACTATACGGAAACGGAGGACG
GCCACGCATTCGCACAAGTGCGCATGGAGGAGATTCACGCGCAGGGCGCACGCGCGCAAGGCGAGGGCAA
CCTGCGCAACGTGGTGTGCGGCACGACGTTCGTGCTGGCCGGCCATCCGATGGCGAGCGCCAACCGCGAG
TATCTGGTGATCGCGTCGGAGCTGGACGTGAAGGAAACCGGCGAGACGACCGGCTTCTCCGCCTACGCGA
TTCGCAGCAGGTTCACCGTACAGCCGTCCGACGTTGTATTCCGTCCGCCGCGCACGATCAGGAAACCGCG
TACGCGCGGCCCGCAGACGGCGATCGTGACGGGCCCGCCGGACGCGGAGATCTGGACGAACAAGAACGGC
GAGGTGACGCTCAAGTTCCATTGGGACCGATCCGACGTGAAGGATCAGAACTCGTCCTGCTGGGTGCGCG
TGTCCTATCCGTGGGCCGGCAGCAACTTCGGCGGCATTCATGTTCCGCGGGTCGGCACCGAAGTCATCGT
CGATTTCGAAAACGGCGATCCGGATCGACCGATCGTGACGGGGCGCGTCTACAACGCGATGACGATGCCG
CCGTGGAGGCTGCCGGCTCACGCGACGCAAAGCGGGATCCTCACGCGCTCGACCAAGGGCGGCGGATACG
GCAACGCCAATGCGATCCGCTTCGAGGACAAGAAAGGAGCGGAGCAGGTCTGGATCCAGGCCGAGCGCAA
TCTCGATGCGGTGATCGAGGCCGACGAAACGCACACGGTCGGGCATGACCGCACGAAGCGGATCGGCCAC
GATGAAACCGACCAGATCGGGCGACACTGGACGCTGTCGACCGGCGGCTACAAGTTCGAGACCGTGACGC
TGGCGTCGGTGAAGAGCGTGGGCATGGGCGCGATGTTCAACGTCGGGATGGCCTACAACGTCAACGTCGG
CGGGCTGTACCTGCGCAACGTCGGGCTGCAGATGGCCAGCACGGTGGGCCGCAGTCGCACCGACCGCGTC
GTGCAGGACTGGACGGCCGATGTTGGGCACACCTATACGCTGACCGTGCGCGGCAAGGCGGTGGGCGATG
CCGTGGCCGCCGATCGGGCGAATCCGATCGAGCCGTCGCCCGACTTCGCGCCGCAGCTGCCCGCACCGGT
ATCGAGCTCGAACGCCAACCAGCTGCGCATCGCGGATACGGGCGAGAGCAGCCTGTCGGGCGCGAAACAG
ACGCAACTGATCGGGCCGGGCGGCACGGTGACGATCGACGAGTCCGGCATTCATCTGAAAGGCACGGCGA
TTTACCTGCAGGCGCCGACGATCAGCATGACGAACGGCAATGCCGGTGGCCTCGCGCCGGTGACCGAAGC
CGACTGCGCGGAATGCGCGAAGAAGAGCGTCAGTGCGAACCCGGTCGATCTGGCGACGGGGCAGAAGGTG
CTGTCGCATACGGACTTTACGTTGCCCGGCCGCGTATCGATCGACTGGAGCCGGAGCTACCGTAGCGCGG
ATCAGCGCCGCGGCAGTCTGGGCGTTGCATGGAAGCTGCCGTATGCAACGGAAGTGCGCACGAGCGCGAC
AGGCTTGATCTACTTCGACGCCGACGGGCGGCAGTTGCAGTTTCCGGCCTTGAACCCAGGCGAAGCGCAT
TTCCATCCGATCGAGAAGTTCACGCTGATGCGCGGTGACGACAACGCGTCGGGCGCCACCTATGCGCTGC
GTTTCGGCAATGGCGTCGAAGAGCATTACGGCCGTCACCCGGTCGACGAGACGCGCTGGCAATTGCAACG
CATCGCGACGCGCGACGGCCAGTGCCTGACGCTCGGCTATACGGCACAGGGCTGGTTGGAAACAGTTCGC
AACAATGTGCATACCGTGCGCTGCGCGCTCGACGATGCCGGCCGGATCACGAGCGTGTTGCTCGACCAGG
GTGTCGGCAATCAGCCGCTGCACCTGACGAGCTACGTGTACGACGAGCACGGCGATCTGGTCGAGGCCAC
CGATCGCGAGAACCTGACGTGGCGCTACGGCTACGACAACCATCTGCTGACGACCTACCGCACGCCGGCC
GGCGCGACGCACGTATCGGAGTGGAGCGACGACACGCCGAATGCGTACTGCCTGCGGACCTACGCCTATA
CCGAAGGCGCCGACGGGCAGCGAGTCGTCACACGCGAGATGCGTTTCGATTACCTGCCGTCGCTGCGCGC
GACGCGGGTGACGGACGGCCTCGGGCATACGACCGAATATCACTACAACGGCCTGTGGGCGGTCGAGAAG
ATCGTGCATCCCGACGGCAGTGTCGAGCAGACGCATTTCGACGAGACGGGGAGCGTGGCCGGCTACACGG
ATGCACTCGGTCGCACGACGCGGATCGTGAACGATGCGCGCGGCAATCCGACGTCGATCATCGACCCGGC
CGGCAACGTCACGCGCATCAGCTATGGCGAGCACAACCTCCCGGAACAGATTACCGACCCGGCCGGGCAG
ATCTGGCAGCGCGGCTACGATGCGCACGGTCACCTGACGAGCGAAACCGATCCGCTCGGCAACGTGACGC
GTTACGCCTACGAAAACGGCTTGCCCGTCGCGCGCACGGATGCACTGGGGAACGTGACGAAGATGCAATG
GGACGACGCGGGTCAGCTCGTGGCGCGCACCGATTGCTCCGGACACACGACGACCTATGACTACGATCCG
TTCGGCCAGTTGACCGAGACCACCGACGCGCTCGGTCAGGTGAGCCACCACAGCGGCAGCGTGTCTGCGC
GCGTGACGGCGGTGCAGCCGGCCGGCATGGGCTGGTGGAAGGTCGAATACGACGAAGCGGGTCGCGCGAT
CGCGCATACGGATCCGCTCGAGCGCGTGACGCGCGTGGACTGGGACGGTTACGGGCAGCGAACGCAGATC
GTCGATCCGGCGGGCGGGACGCAACAGTTCCGATATGACGCGATCGGCCGTTTGACGAAGCTCACCAATG
CGAACCAAGAGACGACTACGTTCCGCTACGACAGCCGCAACCGCTTGATCGAACAGACCGGCTTCGACGG
CCGTCGGCAGAGCTACCGGTACAACGCGGCGGGCGAACTGGTCGAGCGCATCGATCACGGCCAGGACGGA
CAGATCGCGACGCACGTGACCTACGACGTGCTTGGCCGCCCGGTGGAGCGACGCTCGAGCGATGGGAGCC
AAGCGAGCTATCGCTACGACGAGCGCGGGCTGCTGACGCAGGCGCAGGCGATCGTGCCCGGGCGTGCGCC
GGTGCACGTCACTTACGAATACGACGCAGCCGGGCGCCGCACGGCGGAGGTGCAGGCGCATCACGGGCGG
GTCTGGCGGCTCACGCACGGCGTGGACGCGATCGGGAATCGCGACTGGACGCACGTGCCGGACATCGGTT
CGCTGGTCTGGCAGCGCTACGGCTCGGGGCATGTGCACGGCATCCTGCTCGACGAGCATCCGCTGGCGAG
TTTCGAGCGCGACGCGCTGCATCGGGAAATCCGGCGTACGCAAGGTCCGGCGTCGCATCACTTCGGGTAT
GGCGCGAATGGCCTGCTGGCGGTGCATCGCTGGCAGAACCTCGATGAACGGGGGCGCTCGCTGGAGCATC
CGCGGCCGTGGCGGGCGTGGGCATACGACGACGCCGGTCAGCTGACGACGCTGGACGATGCGTGGCGCGA
TCAGAAGGCGTATCGGTACGACGCGCTATCGCGGCTGACGCAGGTGATGGCGGCGAGCGGACCGGAAGCG
TTTCATTACGATCCGGCGGGAAACCTGCTGGCTGCTGCGCCGAGCCGGGACAACATGCAGGCGTGGAAGG
CGAGCGGCGATCGCTTGCTGCGGTTTGCGCCGCAGACGCGCCCGGATCGTCCGGTGGATTTTACGTACGA
CGGGCATGGCAATCGCATTGCGCGGACGGTGCCGTTGCCGCCGAAGCCGGCGCTGACGGAAGCGGAGAAG
CGCAGCCAGCGCGGGACGGACAACCTGCTGCGCGTGATGGAAGTGCTGACGGGGACGCCGAAGTACGAGG
AGCCGTCGGAAGTGCCGGAGGTGACGCGGTATCGGTACGACGGCAGCCACCAGTTGATCGCGATCGAACA
TGCGGACGGGGCGAGAAGCGAGTACGAATACGACGCGCTCGGTCGGCGGGTGGCGAAGCATCACACGCCG
GCGGGCGGCGCGCAGCAGACGACGCTGTTCATGTGGGACGGCGACTGGATGATGCAGGAGGTGCGCACGG
GGCGCACGTCGCATGAGGACAGGGCGGTGACCTATGTGCCGCATCCGGATCATGAAGGACCGTTGACGCG
GCTGGCGGATGGGCAGGCGTGGCACTACGTGACGGATCACCTGGGGACGCCGCAGGAACTGTACGACGAA
CAGCGCGAGGTGTTGTGGGCGGCAGATTTGAGCGCGTATGGACGTACGGCGAGGTGGTTGACGCGTGTTG
TTGACAATCCGATACGTTTTCCGGGGCAGTACCGGGATGAGGAGTCAGGGCTGCATTACAACCGGTTCAG
GTACTACGATCCGATGGTGGGGCGGTATATCAATCAGGATCCGATCGCCTTTGATGGTGGAATCAATTTT
TACAGCTATGCAGATAGTGCGCCTAACATTGCTTACGATCCGAAAGGCCTATTTGTTCCATTGATCGCTG
TTGCTTCATTTTTGGGGAGAGGGGCGCTTGGTGGGGCGGTCGAAATTGCTATGCAAGGGGCAAAGCAAGT
ATTCAGGCAAGCAAAAAATAATTGGGTTGATGGGCGTCCGCTAACCGATATTGATTGGGATTGCGTAAAA
ATCGACTGGACAGATGTGGGGGTTTCAGTCGCCGTCGGAGGCGTGGCGCCTAGTTTGGGGGCGACTAGAA
AAAGCGTAACTAGATCCATAAAAGCCATTAGAAATCTATCTAATCAATCCGCTAACACGGCAAATCGCGC
GGCAAAATTGAAGGTGCGCGTTGACATTAAAAAGGATTCAATCAAACGCGATTTGATCGTGCAGGGGGCA
TGGCAAGGAATTAAGCAGGGTGCAAAGTGTGCTTTTGGTGAGGAGAAAAAATGCGAGGAAGAGTAG
 Primer design