SecReT6
Protein ID: 161519730
SecReT6 ID240
T6SS typeN/A
Gene symbol-
Locus tagBmul_3181
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010086] [Browse all T6SS(s) in this replicon]
Location [Strand]34545..35486 [+]
Producthypothetical protein
NoteTssL
UniProt IDA9AKV1
KEGG IDbmj:BMULJ_05344, bmu:Bmul_3181
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.90E-48, Aligned region: 72..279
Protein Sequence: 313 a.a.     [Download]
>gi|161519730|ref|YP_001583157.1| hypothetical protein Bmul_3181 [Burkholderia multivorans ATCC 17616]
MKGISSATQSDSAPKIVSAKRTSAPPRQPNGTFLSNRDPRQQPGPRRNRPFGPLAPPEDEPTRLAAVLGH
RNALLEAGRVLLRALVDMSALIDTGHDARLRDLLLEEVRVFERLCVRANIRVDHRIGARYCLCTALDEAA
MRELAARGDASGSAAWASDALTQRIGEDNQGGSKVYALTLRLLDDAADHWPLLELIYRIFSLGFEGRYPH
GRTFSAHDRVRERIYNAIAAHLPTVPNALSPHAATIESARPRACFEMPVWLSAAVLSAALCALYVYCRIE
SGAQADDVQRQLSNIARTAPYSAIDPPQGDPAR
 
Nucleotide Sequence: 942 bp     [Download]
>gi|161519706|ref|NC_010086.1|:34545-35486 Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence
ATGAAGGGAATTTCGAGCGCGACGCAATCCGATAGCGCACCCAAAATCGTGTCGGCGAAGCGCACGTCCG
CGCCACCGCGACAGCCAAACGGCACGTTCCTCTCAAACAGGGATCCACGACAGCAACCCGGCCCGCGCCG
TAATCGTCCATTCGGGCCACTTGCGCCGCCCGAAGACGAACCGACGAGACTGGCAGCGGTACTTGGCCAC
CGTAACGCCTTGCTGGAAGCGGGCAGGGTGCTGCTTCGGGCGTTGGTCGACATGTCCGCATTGATCGACA
CCGGCCATGACGCACGCCTGCGCGACCTGCTGCTGGAAGAAGTCCGCGTATTCGAGCGCCTGTGCGTACG
GGCCAACATTCGCGTGGACCACAGGATCGGCGCCCGATATTGCCTATGCACTGCACTGGACGAAGCTGCA
ATGCGCGAACTTGCGGCGCGCGGCGACGCGTCGGGAAGCGCTGCATGGGCGTCAGACGCGCTGACTCAAC
GGATCGGCGAGGATAACCAGGGCGGCTCGAAGGTCTACGCGCTTACGCTGCGCCTGCTCGATGACGCCGC
CGACCATTGGCCGTTGCTCGAACTGATCTACCGGATTTTCAGCCTGGGGTTTGAAGGCCGGTATCCGCAT
GGCCGGACGTTCAGCGCGCACGACCGCGTACGAGAGCGAATCTACAACGCGATTGCGGCGCATCTGCCCA
CCGTCCCGAACGCGCTGTCGCCCCACGCCGCGACGATCGAATCGGCGCGACCGAGAGCCTGTTTCGAAAT
GCCGGTGTGGCTGTCGGCGGCCGTGCTGTCAGCGGCGCTCTGCGCGCTGTATGTCTATTGCCGCATCGAG
TCGGGCGCGCAAGCCGACGACGTGCAGCGCCAACTTTCCAACATCGCGCGCACCGCGCCATACAGCGCGA
TCGACCCGCCGCAGGGCGATCCGGCGCGCTAG
 Primer design