SecReT6
Protein ID: 161519731
SecReT6 ID240
T6SS typeN/A
Gene symbol-
Locus tagBmul_3182
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010086] [Browse all T6SS(s) in this replicon]
Location [Strand]35515..39468 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDA9AKV2
KEGG IDbmj:BMULJ_05343, bmu:Bmul_3182
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.70E-83, Aligned region: 594..914
ImcF-related_N [PF14331], Evalue: 9.60E-79, Aligned region: 281..547
DUF1215 [PF06744], Evalue: 5.90E-33, Aligned region: 911..940
DUF1215 [PF06744], Evalue: 5.90E-33, Aligned region: 1023..1147
Protein Sequence: 1317 a.a.     [Download]
>gi|161519731|ref|YP_001583158.1| type VI secretion protein IcmF [Burkholderia multivorans ATCC 17616]
MKKILSFPSWRHLWAVVMVIAAVVVIWFAGPLLTFGGLSPLASIGIRLTLIALVLAAWALWLIDWTMSIV
IVVLLCLAIWHAFPLVTLSGKPLFASVTARILAMIGVVFVYAGVMSVRWWRQMRRHPGRLRRWLRLGKRG
PRPLAASRLAEIEDMARATIAQLKAGRAVHGRLARLFRGAAHLYDVPWYVVLGPKGSGKTSMLLNSGLAF
PLDARLQHSLAPDDARALPGWRLTNEAVLIDTAGHYVQHGTSRYSLPVASSDGPNGGKRKKQPPDMAAVR
RQSDSAEWHGFLRLLRRIRPRLPLNGVLLTIDVAALAHADPAAHTTESRALRARLEEMQAEFGTGFPVWL
VVTKMDRLPGFTDYFAALGQAERAQILGVTLGSGQQARMNDAIRTELNLLATRLADGVTSLLRNEADMDR
RRRLAVLPESVAALVNPLADLIEHVFARDDNGGPTQPRAMFRGVYLTSAIQGDHAIAAERRTLLRRMIDA
SGTTRRAPRPARGETGYFLRDLWLAVVFREGHLASPNWNREHRVRLQRWLGHSLVWLIAAAMCVNLWNGF
VTERTSLATLGQNARSLAALLARNDLSADPERVPMVLNRAKELLHDATRLATDADGTFRFATARLETIAS
DSRHAYEALSDQAVLPHIVRRMEGAISSAVAIGDAQAAYDALRVYLMLHDRERFNANDVRMWVLDDWWRH
DSAATFGGRAAMMGHVERLFSEGHVVRSPLSRNDALIRQARVFLDGSDLIERLYRRAKATMWKDAPDDFS
LLRMVGTQAGMVFTCVSGAPLSGGVPGIFTREGYQAVFSKRLPEFLRAASDDDAWVMGRRASGDPRRHSA
GTLNAPNQDDDALLAAITRRYLLEYAQQWDAFLGDIRIVSGTSLAFNLKILRTLAAPDSPLTRLARAAVI
ETTLTQPMAKSDGALLAKATDAIHQKAETVLGPRASEQLEREWVDRHFAALREVVTGHADTRSDTQPVET
SAGRTGLDGIADLLNDYYAALAIADNALLNNSMPPASEHAAKLKMMADTMPAPLRAVLHQLAVEGSRGVN
QGIGRLLSRQVQAAIGDVCRTTIEGNYPFSPDSSRDVGIDDFTRMFAHGGVIDDFFTRTLAPFVDTAAKP
WRYRTLPGATEAVQGPDLAPFEHAKAIRDIFFNEVDRTRPSWKVDIRIPELDPTIMSLSLDIDGQTTRYR
HGPVEPFTVTWPGPRGGAHAWLVASPSIGPNTWTIAADGPWALMRLLRKGHVIETATLGRTRVVFSFDGR
EAALDIASAGSAGNPLTSDVLATFRCPGTMAMFNLPDSGPPPGLPHGRLPAMPDSGL
 
Nucleotide Sequence: 3954 bp     [Download]
>gi|161519706|ref|NC_010086.1|:35515-39468 Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence
ATGAAGAAGATTCTCTCGTTTCCAAGTTGGCGTCATCTGTGGGCGGTCGTGATGGTGATCGCTGCCGTCG
TCGTGATCTGGTTTGCAGGACCGTTGCTGACTTTCGGCGGACTGAGCCCGCTCGCCTCGATCGGCATTCG
ACTGACGTTGATCGCTTTGGTACTCGCCGCATGGGCCTTGTGGCTGATCGACTGGACGATGAGCATCGTG
ATCGTCGTGCTGCTCTGTCTCGCGATCTGGCATGCGTTTCCGCTCGTGACGCTGTCTGGCAAACCGCTGT
TTGCTTCCGTAACGGCCCGCATTCTGGCAATGATCGGTGTGGTGTTCGTTTATGCCGGCGTCATGTCGGT
CCGATGGTGGAGGCAAATGCGCCGGCACCCCGGTCGGCTCAGACGATGGCTTCGACTCGGCAAACGTGGC
CCACGGCCGCTGGCCGCATCGCGCTTGGCAGAAATCGAGGACATGGCGCGCGCAACGATCGCGCAGTTGA
AAGCCGGGCGAGCGGTCCACGGGAGGCTGGCGCGACTGTTTCGAGGCGCAGCACATCTCTACGATGTGCC
TTGGTACGTCGTGCTGGGTCCGAAGGGTTCGGGCAAGACCTCGATGCTGCTCAACTCCGGCTTGGCGTTT
CCGCTCGATGCTCGACTTCAGCATTCGCTTGCACCCGATGACGCACGGGCCTTGCCGGGATGGCGGCTGA
CCAATGAGGCGGTGCTGATCGATACGGCGGGTCACTACGTACAACACGGCACGTCGCGCTACTCGCTGCC
GGTGGCGTCGTCGGACGGGCCGAACGGCGGCAAGCGGAAAAAACAGCCACCCGACATGGCCGCCGTTCGC
AGGCAGTCCGATTCCGCGGAGTGGCACGGGTTTCTTCGGCTGCTTCGCCGTATCCGGCCTCGCTTGCCGC
TGAATGGCGTGCTGTTGACGATCGACGTCGCTGCGTTGGCGCATGCGGATCCTGCCGCACATACGACCGA
GAGCCGCGCGTTGCGGGCTCGCCTCGAGGAGATGCAAGCCGAATTCGGCACCGGGTTTCCCGTCTGGCTG
GTCGTCACGAAAATGGATCGGCTCCCGGGGTTCACCGACTATTTCGCGGCGCTCGGGCAAGCGGAGCGTG
CGCAGATTTTGGGTGTGACGCTCGGGTCCGGCCAGCAGGCGCGGATGAACGATGCGATCCGGACAGAACT
GAATCTGCTTGCCACGCGTCTCGCCGATGGCGTCACGAGCCTGCTTCGCAACGAAGCCGATATGGACCGC
CGGCGCCGTCTTGCGGTGTTGCCCGAATCGGTTGCGGCACTGGTGAACCCGTTGGCCGACCTGATCGAAC
ACGTGTTCGCCAGGGACGACAACGGCGGGCCGACGCAACCGCGTGCGATGTTCCGAGGCGTTTATCTGAC
GAGCGCAATCCAGGGTGATCACGCGATCGCTGCGGAACGTCGAACGCTATTGCGACGCATGATCGACGCA
TCCGGCACAACACGGAGGGCCCCGCGGCCGGCGCGTGGCGAAACCGGTTACTTCCTGCGCGATTTGTGGC
TCGCGGTCGTGTTTCGTGAAGGGCATCTCGCGAGCCCTAACTGGAATCGCGAGCATCGGGTACGACTGCA
GCGGTGGCTGGGACACTCGCTCGTGTGGCTGATTGCGGCCGCAATGTGCGTCAATCTTTGGAATGGCTTC
GTCACGGAACGAACATCGCTTGCGACGCTCGGGCAAAATGCACGGTCACTCGCCGCATTACTCGCACGAA
ACGACCTTTCCGCCGATCCCGAGCGTGTGCCGATGGTGTTGAACCGTGCGAAGGAATTGCTGCATGACGC
GACGCGTCTCGCCACCGATGCCGACGGCACGTTTCGTTTTGCGACGGCCCGCCTCGAGACGATCGCGTCC
GACAGCCGCCATGCGTACGAGGCCCTGTCGGACCAGGCCGTGTTGCCGCACATCGTCCGCCGCATGGAGG
GCGCAATCAGCAGTGCTGTGGCGATCGGCGACGCCCAAGCCGCTTACGACGCGTTGCGCGTGTACCTGAT
GCTCCACGACCGAGAGCGTTTCAACGCGAACGACGTCAGGATGTGGGTGCTCGACGATTGGTGGAGGCAC
GACAGCGCGGCCACGTTCGGTGGGCGTGCCGCAATGATGGGCCACGTCGAACGGCTGTTTTCGGAAGGAC
ATGTCGTGCGCTCGCCACTGTCGCGTAACGATGCCTTGATCCGGCAGGCACGTGTCTTTCTCGACGGCAG
CGACTTGATTGAACGTCTTTACCGGCGCGCCAAAGCGACGATGTGGAAGGACGCGCCGGACGATTTTTCG
CTGCTGCGGATGGTTGGAACGCAGGCCGGCATGGTGTTTACGTGCGTCAGCGGCGCGCCCTTGTCCGGCG
GCGTGCCGGGAATCTTTACGCGAGAAGGCTATCAGGCGGTGTTCAGCAAACGCTTGCCGGAATTCCTTCG
CGCGGCCAGCGACGACGACGCCTGGGTAATGGGACGTCGAGCATCGGGCGATCCTCGCAGGCATTCCGCT
GGCACGTTGAACGCCCCGAACCAGGACGACGACGCGCTGCTGGCAGCGATTACGCGCCGGTACCTGCTCG
AGTACGCGCAACAATGGGATGCGTTTCTTGGCGACATCCGTATCGTGAGCGGAACGAGTCTCGCGTTCAA
CCTCAAGATACTGCGAACGCTCGCCGCGCCGGATTCACCGCTGACGCGTCTGGCCCGGGCGGCGGTAATC
GAAACGACGCTGACACAGCCCATGGCGAAGTCGGACGGCGCCTTGCTCGCAAAAGCAACCGACGCGATCC
ACCAGAAAGCCGAGACAGTACTGGGGCCTCGTGCATCGGAACAGCTTGAACGCGAGTGGGTCGATCGTCA
TTTCGCGGCATTGCGCGAAGTCGTGACGGGCCATGCCGATACACGCTCGGATACGCAGCCGGTGGAGACG
TCCGCGGGAAGAACGGGCCTGGACGGAATCGCCGATCTGTTGAACGACTACTACGCAGCGCTCGCAATTG
CCGACAACGCGCTGCTGAACAACAGCATGCCGCCGGCAAGCGAGCACGCCGCGAAGCTGAAGATGATGGC
CGATACGATGCCCGCGCCGTTGCGGGCAGTGCTGCATCAACTCGCCGTCGAGGGCTCGCGCGGAGTCAAT
CAGGGTATCGGCCGGCTGCTGTCGCGCCAGGTGCAGGCGGCAATCGGGGACGTTTGTCGAACGACGATCG
AAGGCAACTACCCGTTCTCGCCCGATAGCAGCCGCGACGTCGGTATCGACGATTTCACGCGGATGTTTGC
GCACGGGGGCGTGATCGACGACTTCTTCACGAGAACGCTTGCTCCGTTCGTCGATACCGCGGCGAAACCG
TGGCGCTACCGGACGCTGCCGGGCGCGACCGAAGCCGTCCAAGGGCCCGACCTCGCGCCATTCGAGCATG
CCAAGGCAATCCGCGACATTTTCTTCAACGAGGTTGATCGCACGCGACCGAGCTGGAAGGTCGACATCCG
CATCCCTGAACTCGATCCGACGATCATGAGCCTGTCGCTCGACATCGACGGACAGACGACGCGTTATCGA
CATGGCCCGGTCGAGCCTTTTACGGTGACCTGGCCGGGACCGCGCGGTGGCGCACACGCATGGCTCGTCG
CGAGCCCGAGCATCGGGCCGAACACGTGGACGATCGCAGCGGACGGACCGTGGGCGCTCATGCGTTTGCT
TCGGAAGGGGCACGTAATCGAGACGGCCACGTTGGGCCGCACGCGCGTGGTGTTCAGCTTCGACGGTCGC
GAAGCGGCGCTCGACATCGCGAGCGCGGGAAGTGCCGGGAATCCGTTGACGAGCGATGTGCTCGCGACGT
TCCGCTGTCCGGGCACGATGGCGATGTTCAACCTGCCGGATAGCGGCCCGCCGCCGGGATTGCCGCACGG
CAGATTGCCGGCAATGCCTGACAGCGGGCTTTGA
 Primer design