SecReT6
Protein ID: 161520470
SecReT6 ID241
T6SS typei3
Gene symbol-
Locus tagBmul_3922
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010086] [Browse all T6SS(s) in this replicon]
Location [Strand]891119..895219 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDA9AQ82
KEGG IDbmj:BMULJ_04579, bmu:Bmul_3922
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 7.70E-96, Aligned region: 642..962
ImcF-related_N [PF14331], Evalue: 7.10E-94, Aligned region: 326..595
DUF1215 [PF06744], Evalue: 1.60E-33, Aligned region: 968..987
DUF1215 [PF06744], Evalue: 1.60E-33, Aligned region: 1072..1195
Protein Sequence: 1366 a.a.     [Download]
>gi|161520470|ref|YP_001583897.1| type VI secretion protein IcmF [Burkholderia multivorans ATCC 17616]
MKKFPFLPFLASRQFLAFLALIVVALVIWFVGPFFTFGGLKPFADAGMRALLIALLLAGVLLWLVGWSIS
IVLAALFCLLIWYAGPLLALGRTVPLESASARLGAIAVVAAVFVVVGMFRIWQKMREDAAFMKKMLRLDR
KKADPLAASRLEKVEGGVTSALARLKSMRTGARGLGKLFQGKRYLYELPWYITLGSQGSGKTSILMNGGL
AFPVAEQMQRAAAKPAADAAAVDWWLTNDAVLIDTTGYYTRHGMSTADAAGTRVAEQQDKPAPDVSDKDT
ANAQANSERSADGTQQGAPAKSEATAGSKSSVDVVPRAADRRELPQQIDRAEWFGFLGLLRRHRPRAPIN
GALLTVDLATLASADEQARVAEAAALRARLAELREELGVRFPVYLTITKMDRLAGFAEYFGTLTSEGRAQ
VWGFTLPYGKETVAKEGLRARCHHELAQLAQRLTGSIDTHLQDEYDLNKRRKLAALPEAFSALLEPLLDL
IDHVFLDSRYDNTQLHSTLRGVYFTSARQQGSEIVAERHTVVQRLLSTEKPAAVAPSRAEGNQGFFLHDL
LTRVVFPEAHLVSPNLRWEYRYRLVRLIGHTLALLLFVWLAIGLRVSYGNNSDYLDAMGRKAQALAGRVA
ALYKTPELQAVPDTLTEARNLPTFSGLDLSDPDSAWRYGLYTPTDIATESRRTYDVLEDNLLLPQILHRL
EDVMSGAIANKDSKAAYDALRVYLMLYDKAKFNAGDVKAWVLDDWAKNDSAAAFGGRASMIEHVQQLFSG
ERVVQSSLIRNDALVRQTRAFLDGSNATDRLYQRAKAAMLMEAPDEFTLLRAVGPQAGTVFTRASDAPLS
RGVSGLFTFDGYRNLFDKRLREFVQLARDDDAWVMGRSYLGEAQKKTAEIVNGAAGADDALTDAVRREYL
TEYAQQWAAFLDDIRTVSGTSLAFNLKVLRSFAAPDSPLARLARAAVRETTLTQQPVASNGSLLQKAADQ
LNQKADKALGIRASERVERELVDNRFAALREVVTGSADALSDAHSAGTQADKTGLDGVVNLLNDYYTALT
VADNALSNNSMPPASDTAAKLKMAADTMPAPFRAILLKLAADGSREVNHGIGQLLSRQMQAVVGDTCRLT
IEGNYPFSPDSQRDVGIDDFTRVFAQGGVIDDFFVKTLAPFVDTSAKPWRYRTLPGATEPVQGPSLEPFE
HAKAIRDIFFNDPDHKQMTWKADIRVPELAPTIMSLSLDIDGQTTLYQHGPVAPFTIAWPGPRGGAHAEI
AAGPRIRPDTSTISADGPWALMRLLQKGKVIATATPGRTRVAFGFDGREAVLDIASAGSVANPLTSDVLK
TFRCPTSMATFSLPDSGPPPGLPQGMLPMNAGSVSR
 
Nucleotide Sequence: 4101 bp     [Download]
>gi|161519706|ref|NC_010086.1|:891119-895219 Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence
ATGAAGAAGTTTCCGTTCCTGCCGTTTCTGGCCTCGCGCCAGTTCCTCGCGTTCCTCGCACTGATCGTCG
TTGCACTGGTGATCTGGTTCGTCGGTCCGTTCTTCACATTTGGCGGGCTCAAGCCATTCGCGGATGCCGG
CATGCGTGCGCTGCTGATCGCGTTGCTGCTCGCCGGTGTGCTGCTCTGGCTGGTCGGATGGTCGATCAGC
ATCGTGTTGGCGGCATTGTTTTGCTTGCTGATCTGGTACGCGGGCCCGTTGCTTGCGTTGGGTCGCACGG
TACCGCTGGAATCGGCGTCGGCACGTCTTGGCGCGATCGCGGTGGTGGCAGCCGTTTTCGTCGTCGTCGG
CATGTTCCGTATTTGGCAAAAAATGCGCGAAGACGCCGCGTTCATGAAGAAGATGCTGCGTCTGGATCGC
AAGAAGGCGGACCCGCTTGCAGCTTCACGTCTTGAGAAAGTCGAAGGCGGCGTGACGAGCGCGCTCGCGC
GCCTGAAATCGATGCGTACCGGCGCACGCGGCCTCGGCAAGCTGTTCCAGGGCAAGCGCTATTTGTACGA
GCTGCCCTGGTACATCACGCTCGGCTCGCAAGGATCCGGCAAGACGAGCATCCTGATGAACGGCGGGCTG
GCATTTCCCGTTGCCGAGCAGATGCAGCGCGCGGCCGCGAAACCGGCTGCCGATGCCGCCGCCGTGGACT
GGTGGCTGACGAATGACGCAGTGCTGATCGACACGACCGGCTACTACACGCGTCATGGCATGTCGACGGC
CGATGCCGCCGGTACACGAGTCGCAGAACAACAGGACAAGCCGGCACCTGACGTGTCCGACAAGGATACC
GCCAACGCGCAGGCGAACTCGGAACGTTCCGCCGATGGCACGCAACAGGGCGCGCCTGCGAAATCGGAGG
CGACGGCCGGCTCGAAGTCGAGTGTCGATGTCGTACCGCGTGCTGCCGACAGGCGCGAGCTTCCGCAGCA
GATCGATCGCGCGGAATGGTTCGGCTTTCTCGGCCTATTGCGTCGACACCGGCCTCGTGCGCCGATCAAC
GGCGCATTGCTGACGGTCGATCTTGCGACGCTGGCAAGCGCGGATGAACAGGCGCGCGTCGCCGAGGCTG
CCGCATTGCGCGCAAGGCTCGCCGAACTGAGAGAGGAACTGGGCGTTCGCTTCCCCGTTTACCTGACGAT
CACGAAGATGGACCGCCTCGCGGGCTTTGCCGAGTATTTCGGGACGCTCACGTCCGAGGGGCGGGCGCAG
GTCTGGGGTTTCACGCTTCCATACGGCAAGGAAACGGTTGCGAAGGAAGGGCTGCGTGCGCGTTGTCACC
ACGAACTCGCGCAACTCGCGCAACGGTTGACGGGCTCGATCGATACGCATCTGCAGGACGAATACGACCT
GAACAAGCGTCGAAAGCTTGCCGCGTTGCCTGAGGCGTTTTCGGCACTGCTCGAACCGCTGCTCGACTTG
ATCGACCACGTATTCCTCGATTCCCGCTACGACAATACGCAGCTCCATTCGACGTTGCGCGGCGTGTATT
TCACGAGTGCCCGGCAACAGGGCAGCGAGATCGTGGCGGAACGCCATACGGTCGTTCAACGTCTTCTGTC
GACTGAGAAGCCGGCCGCGGTCGCACCGTCGCGCGCGGAGGGGAACCAGGGATTCTTCCTGCACGATTTG
CTGACCCGTGTCGTGTTCCCCGAGGCGCATCTCGTGAGCCCCAACCTGCGTTGGGAATATCGCTACAGGC
TGGTGCGCCTGATCGGCCACACGCTGGCGCTGCTGCTGTTCGTCTGGCTGGCGATCGGTTTGCGCGTGAG
CTATGGCAACAACAGCGATTATCTCGACGCGATGGGCCGCAAGGCGCAGGCGCTTGCCGGCCGCGTCGCG
GCGCTGTACAAGACGCCCGAACTGCAAGCCGTGCCCGACACGTTGACCGAGGCGCGCAATCTGCCCACGT
TTTCGGGGCTCGACCTGTCCGATCCGGACAGTGCATGGCGCTACGGTCTGTACACGCCGACGGACATTGC
CACCGAAAGTCGCCGCACTTACGACGTACTCGAAGACAACCTGCTGCTGCCGCAGATCCTGCATCGTCTG
GAAGACGTCATGTCCGGTGCGATTGCGAACAAGGATTCAAAGGCCGCGTACGACGCGCTTCGCGTATACC
TGATGCTGTACGACAAGGCGAAGTTCAATGCCGGCGACGTCAAGGCATGGGTACTCGACGACTGGGCGAA
GAACGACAGCGCCGCCGCTTTCGGCGGCAGGGCGTCGATGATCGAGCACGTGCAACAGCTCTTCTCAGGG
GAGCGTGTCGTGCAGTCTTCGCTGATCCGCAACGACGCGCTGGTACGGCAGACGCGCGCGTTCCTTGACG
GCAGCAATGCGACCGATCGTCTGTACCAGCGCGCGAAGGCCGCGATGCTCATGGAAGCACCCGACGAGTT
CACGTTGCTGCGCGCGGTCGGCCCGCAGGCCGGAACGGTGTTCACGCGAGCGAGCGACGCGCCGTTGTCG
CGCGGCGTGTCGGGTCTCTTCACGTTCGACGGCTATCGGAATCTGTTCGACAAGCGACTGCGCGAGTTCG
TGCAACTCGCGCGCGACGACGACGCTTGGGTGATGGGGCGCTCGTATCTCGGCGAGGCTCAAAAAAAAAC
GGCTGAGATCGTCAATGGCGCGGCCGGTGCGGACGACGCGTTGACCGACGCCGTCCGCCGCGAATACCTG
ACGGAGTATGCGCAACAGTGGGCGGCGTTTCTCGACGACATCCGGACCGTGAGCGGCACGAGTCTCGCAT
TCAATCTGAAAGTGCTGCGCAGCTTCGCGGCGCCCGATTCGCCGCTTGCGCGTCTTGCCCGTGCCGCAGT
GCGCGAGACGACGCTCACACAGCAACCGGTTGCGTCGAACGGCTCGCTGTTGCAAAAGGCGGCCGACCAA
TTGAACCAGAAAGCCGACAAGGCGCTTGGCATTCGAGCCTCGGAGCGTGTCGAGAGGGAACTCGTCGACA
ATCGTTTCGCGGCCTTGCGTGAGGTCGTGACGGGAAGCGCCGATGCACTGTCCGACGCCCACTCGGCCGG
TACCCAGGCGGACAAGACGGGACTCGACGGCGTCGTCAACCTGCTGAACGACTACTACACGGCGCTGACC
GTCGCCGATAACGCGCTGTCGAACAACAGCATGCCGCCGGCGAGCGACACGGCCGCGAAGCTCAAGATGG
CCGCCGACACGATGCCTGCGCCGTTCCGCGCGATATTGCTCAAGCTCGCGGCCGACGGGTCGCGCGAGGT
CAATCACGGGATCGGCCAACTGTTGTCGCGCCAGATGCAGGCGGTGGTCGGCGATACCTGCCGATTGACG
ATCGAAGGAAACTATCCGTTCTCTCCGGACAGCCAGCGCGACGTCGGGATCGACGACTTCACGCGCGTGT
TCGCGCAGGGCGGCGTGATCGACGATTTCTTCGTGAAGACGCTGGCGCCGTTTGTCGATACGTCCGCGAA
ACCGTGGCGCTATCGAACGCTGCCGGGCGCGACGGAACCCGTGCAGGGGCCGAGCCTCGAGCCGTTCGAG
CATGCGAAGGCGATTCGCGACATCTTCTTCAACGATCCGGACCACAAGCAGATGACGTGGAAGGCCGACA
TCCGCGTTCCGGAACTCGCGCCGACGATCATGAGCCTGTCGCTCGACATCGACGGGCAGACGACGCTTTA
CCAGCACGGTCCGGTCGCGCCCTTCACGATTGCGTGGCCGGGGCCGCGCGGCGGCGCGCACGCCGAGATC
GCGGCCGGCCCGCGGATCCGGCCGGACACCTCGACGATTTCCGCCGATGGGCCTTGGGCGTTGATGAGGC
TGCTGCAGAAAGGCAAGGTGATCGCGACGGCCACGCCGGGCCGCACGCGTGTCGCATTCGGTTTCGACGG
TCGCGAAGCGGTGCTCGACATCGCGAGCGCCGGCAGTGTCGCGAATCCGTTGACGAGCGATGTGTTGAAG
ACGTTCCGGTGCCCCACCTCGATGGCGACGTTCAGTTTGCCGGACAGCGGTCCGCCGCCGGGATTGCCAC
AGGGCATGTTGCCGATGAACGCCGGAAGCGTTTCCCGTTGA
 Primer design