SecReT6
Protein ID: 161526076
SecReT6 ID239
T6SS typei4b
Gene symbol-
Locus tagBmul_2907
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010084] [Browse all T6SS(s) in this replicon]
Location [Strand]3173757..3177704 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDA9AJ87
KEGG IDbmu:Bmul_2907
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 8.10E-72, Aligned region: 193..451
IcmF-related [PF06761], Evalue: 6.90E-52, Aligned region: 498..878
DUF1215 [PF06744], Evalue: 7.70E-29, Aligned region: 1011..1126
Protein Sequence: 1315 a.a.     [Download]
>gi|161526076|ref|YP_001581088.1| type VI secretion protein IcmF [Burkholderia multivorans ATCC 17616]
MQRILNVLTHPRTLSIVGIVALAAILFIVADMLQLPLLWAAIALAAILALWLAVALWRRWRVKRANRQLG
EVLEEQAETGKIAAPAAAAVAPDAKTADLDALRTRLSDAVKTIKTSKIGQVSGGSALYELPWYIVIGNPA
AGKSSAVINSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLGLLKRY
RPKAPINGIIVTASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSS
DKHEYDRVWGATLPYEPDEKRDVVALFDERFEELYEGLKEISIAQLSLSRGHQLSPGQLSFPLEFSTIKP
ALRAFLATLFENNPFQYKPIFRGFYFTSALQEGETSSAAAQRIAHRFGLDATALPKPHSAFSKNGFFLRD
LFSKVIFADRQTVRQFASPTKTRLRYATFFGFVAALALALGGWTWSTIGNQQLVANVQADLDNVTRLQQG
RNDLQSRLQAMDILEDRIEQLEQFRRDKPLSVSLGLYQGDRLEQHLLTEYYNGVRQILLNPVSQNLASFL
KDVNAHPDQLVPMTRPPESGAVQASALPVSTNPAGAAQQAGAAQPSSSVAGALAAPQPPAAPQGGLYSDA
SPTNVQDAYNALKTYLMLSDKRHVEQAHLTDQLARFWRGWLETNRGNMPRDEMIKSAERMISFYLARVND
DDWPMIDANLALVDQTRENLRRVVRGMPARQRVYEEIKARASTRFAPMTVARIVGDGNQALIAGSYAIPG
TFTRDAWFDYVQPAIRDAATKELQAKDWVLNTSTQDDLTLEGSPEQIQKTLVGMYKTEYAQHWQKFMQGI
AVQGFSSFGQAVDGMNRLGDPQDSPIRKILETAYEQTSWDNPSLANVAIKKAQTGVVNWVKQLFTRSQAG
QVAAANIDINGNPVEVPMGPIGQEFIGLARIVATHDGTSMLKGYMDTLSKVRTRFNVIKNQGDPGPGARQ
LMQQTLDGNGSELADSLKFVDEQMLTGLTDSQRKALRPLLVRPLMQAFSVVIQPASVEVNKVWNAQVYQP
FQSSLATKYPFAANAKVEAGAGEIAQVFGPDGSIAKFVGTTLGPLAVRRGDTLAARTWGDMGLALAPDFT
NGFARWVAPLAGGAAGGAAASSEPQTVFQILPQPSTGTTEYTVAIDGQQLRYRNTPPQWTNFVWPNPQGS
PGATLSATTFDGRTVQLVNEPGRYGLEKLINSAQRKRRPDGTFDLTWTQGSVSVSVTMRIISTSQPTSGG
GDQPQQQSLRGLQLPSSVVDASAGAAQNAAQAGAGAPAAAPTVAAATGSNAQGAQ
 
Nucleotide Sequence: 3948 bp     [Download]
>gi|161523180|ref|NC_010084.1|:3173757-3177704 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGCAACGCATCCTCAACGTGCTGACTCACCCGCGTACGCTCTCGATCGTCGGGATCGTCGCGCTCGCGG
CGATCCTCTTCATCGTCGCCGACATGCTGCAGCTACCGCTGCTGTGGGCCGCGATCGCGCTCGCGGCGAT
CCTCGCGCTGTGGCTCGCGGTCGCGCTCTGGCGGCGCTGGCGCGTGAAGCGCGCGAACCGGCAGCTCGGC
GAGGTGCTCGAAGAACAGGCCGAAACCGGCAAGATCGCGGCGCCCGCCGCGGCGGCCGTCGCGCCCGATG
CGAAGACGGCCGACCTCGACGCGCTGCGCACGCGCCTGTCCGACGCGGTGAAGACGATCAAGACCTCGAA
GATCGGCCAGGTATCGGGCGGCTCCGCGCTGTACGAACTGCCGTGGTACATCGTGATCGGCAACCCCGCC
GCCGGCAAGAGCAGCGCGGTGATCAACTCCGGCCTGCAGTTCCCGTTCGCCGACAAGAACAGCGCCGTGA
TCCACGGCATCGGCGGCACGCGCAACTGCGACTGGTTCTTCACGACCGAAGGGATCCTGCTCGACACCGC
GGGCCGCTACTCGGTTCACGAGGAAGACCGCAGCGAATGGCTCGGCTTCCTCGGCCTGCTGAAACGCTAC
CGCCCGAAGGCGCCGATCAACGGCATCATCGTGACCGCGAGCATCGCCGAACTCACCGGCAACCGCCCCG
AATTCGCGATCAATCTCGCGAAAAACCTCCGTCAGCGCGTTCAGGAGCTGACCGAAAAGCTGGAGGTGTT
CGCGCCCGTCTACGTGATGTTCACGAAGGCGGACCTCATCACCGGCTTCACCGAATTCTTCAGCAGCAGC
GACAAGCACGAGTACGACCGCGTGTGGGGCGCGACGCTGCCGTACGAACCGGACGAGAAGCGCGACGTCG
TCGCGCTGTTCGACGAGCGCTTCGAGGAACTCTACGAAGGGCTGAAGGAAATCAGCATCGCGCAGCTGTC
GCTGTCGCGCGGCCATCAGCTGTCGCCGGGCCAACTGAGCTTCCCGCTCGAGTTCTCGACGATCAAGCCG
GCGCTGCGCGCGTTCCTCGCGACGCTGTTCGAGAACAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCT
TCTACTTCACGAGCGCGCTGCAGGAAGGCGAAACCAGCAGCGCGGCCGCGCAGCGCATCGCACACCGCTT
CGGCCTCGACGCGACCGCGCTGCCGAAGCCGCACAGCGCGTTCTCGAAGAACGGCTTCTTCCTGCGCGAC
CTGTTCTCGAAGGTCATCTTCGCCGACCGCCAGACCGTGCGCCAGTTCGCGAGCCCGACCAAGACGCGGC
TGCGCTACGCGACCTTCTTCGGCTTCGTCGCGGCGCTCGCACTCGCGCTCGGCGGCTGGACGTGGTCGAC
GATCGGTAACCAGCAGCTCGTCGCGAACGTGCAGGCCGATCTCGACAACGTCACGCGCCTGCAGCAGGGC
CGCAACGATCTGCAGTCGCGGCTGCAGGCGATGGACATCCTCGAGGACCGCATCGAGCAACTCGAACAGT
TCCGCCGCGACAAGCCGCTGTCGGTGTCGCTCGGCCTGTATCAGGGCGATCGTCTCGAACAGCACCTGCT
CACCGAGTACTACAACGGCGTGCGGCAGATCCTGCTGAACCCGGTTTCGCAGAACCTCGCGTCGTTCCTG
AAGGACGTGAACGCACACCCCGACCAGCTCGTGCCGATGACGCGGCCGCCCGAATCGGGCGCCGTGCAGG
CGAGCGCGCTGCCGGTATCGACGAACCCGGCGGGCGCCGCGCAGCAGGCCGGCGCCGCGCAACCGTCGTC
GTCCGTCGCGGGTGCGCTGGCCGCGCCGCAACCGCCGGCCGCGCCGCAAGGCGGCCTGTACAGCGACGCG
TCGCCGACCAACGTGCAGGACGCGTACAACGCGCTGAAGACCTACCTGATGCTGTCCGACAAGCGCCACG
TCGAACAGGCGCACCTGACCGACCAGCTCGCGCGCTTCTGGCGCGGCTGGCTCGAGACGAATCGCGGCAA
CATGCCGCGCGACGAGATGATCAAGAGCGCCGAGCGCATGATCTCGTTCTATCTCGCGCGCGTGAACGAC
GACGACTGGCCGATGATCGACGCGAACCTCGCGCTCGTCGACCAGACGCGCGAGAACCTGCGTCGCGTGG
TGCGCGGCATGCCGGCCCGCCAGCGCGTGTACGAGGAAATCAAAGCACGCGCGTCGACGCGCTTCGCGCC
GATGACCGTCGCGCGCATCGTCGGCGACGGCAACCAGGCGCTGATTGCCGGCAGCTATGCGATTCCGGGC
ACGTTCACGCGCGACGCGTGGTTCGACTACGTGCAGCCCGCGATCCGCGACGCGGCGACCAAGGAGCTGC
AGGCGAAGGACTGGGTGCTCAATACGTCGACGCAGGACGACTTGACGCTCGAGGGCAGCCCCGAGCAGAT
CCAGAAGACGCTGGTCGGGATGTACAAGACCGAGTACGCGCAGCACTGGCAGAAGTTCATGCAGGGCATC
GCGGTGCAAGGCTTCAGCAGCTTCGGCCAGGCCGTCGACGGCATGAACCGCCTCGGCGACCCGCAGGACT
CGCCGATCCGCAAGATCCTCGAGACCGCGTACGAGCAGACGTCGTGGGACAACCCGTCGCTGGCGAACGT
CGCGATCAAGAAGGCGCAGACCGGCGTGGTGAACTGGGTCAAGCAGTTGTTCACGCGCTCGCAGGCCGGC
CAGGTTGCGGCCGCCAACATCGACATCAACGGCAATCCGGTCGAGGTGCCGATGGGGCCGATCGGCCAGG
AGTTCATCGGCCTCGCGCGAATCGTCGCGACGCACGACGGCACGTCGATGCTGAAGGGCTACATGGACAC
GCTGTCGAAGGTGCGCACGCGCTTCAACGTGATCAAGAACCAGGGCGATCCGGGGCCCGGCGCGCGCCAG
CTGATGCAGCAGACGCTCGACGGCAACGGCTCGGAGCTCGCCGATTCGCTGAAGTTCGTCGACGAGCAGA
TGCTGACCGGCCTCACCGATTCGCAACGCAAGGCGCTGCGCCCGCTGCTCGTGCGTCCGCTGATGCAGGC
GTTCTCGGTCGTGATCCAGCCGGCCAGCGTCGAGGTCAACAAGGTGTGGAACGCGCAGGTCTATCAGCCG
TTCCAGAGCTCGCTCGCGACCAAGTATCCGTTCGCGGCGAACGCGAAGGTCGAGGCCGGCGCCGGCGAGA
TCGCACAGGTGTTCGGTCCGGACGGCTCGATCGCGAAGTTCGTCGGCACGACGCTCGGGCCGCTCGCCGT
ACGCCGCGGCGATACGCTTGCCGCGCGTACGTGGGGCGACATGGGCCTCGCGCTCGCACCGGACTTCACG
AACGGCTTCGCGCGCTGGGTCGCACCGCTCGCGGGCGGCGCGGCCGGCGGTGCCGCCGCGTCGTCGGAAC
CGCAGACCGTATTCCAGATCCTGCCGCAGCCGAGCACCGGCACGACCGAATACACGGTCGCGATCGACGG
CCAGCAGCTGCGCTACCGCAACACGCCGCCGCAGTGGACCAACTTCGTGTGGCCGAACCCGCAGGGCTCG
CCGGGCGCGACGCTGTCCGCGACGACGTTCGACGGGCGCACCGTGCAGCTCGTCAACGAGCCGGGCCGCT
ACGGTCTCGAGAAACTGATCAACTCCGCGCAGCGCAAGCGGCGGCCGGACGGCACGTTCGACCTCACGTG
GACGCAGGGCAGCGTGAGCGTGTCGGTGACGATGCGCATCATCAGTACGTCGCAGCCGACGAGCGGCGGC
GGCGACCAGCCGCAGCAGCAGAGCCTGCGCGGGCTGCAACTGCCGTCGTCGGTCGTCGACGCGAGCGCGG
GCGCCGCACAGAACGCGGCCCAGGCCGGCGCCGGCGCGCCGGCCGCCGCGCCGACCGTCGCGGCCGCTAC
CGGTTCGAATGCACAGGGGGCGCAATGA
 Primer design