SecReT6
Protein ID: 162418268
SecReT6 ID244
T6SS typeN/A
Gene symbol-
Locus tagYpAngola_A1935
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]2006220..2006570 [-]
Producthypothetical protein
NoteTssM
UniProt IDA9R770
KEGG IDypg:YpAngola_A1935
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 116 a.a.     [Download]
>gi|162418268|ref|YP_001606409.1| hypothetical protein YpAngola_A1935 [Yersinia pestis Angola]
MNFDGNTVRYSHGPVTPAFFKWPGLRQGTIVSLTAQRQKASAMPDILFRGPWALLQWADQADEIRDEANG
KQTLTYLMGKDRVELEVSGLTHGGETISDLLRDFKCPSVNDMNGIW
 
Nucleotide Sequence: 351 bp     [Download]
>gi|162418099|ref|NC_010159.1|:c2006570-2006220 Yersinia pestis Angola chromosome, complete genome
ATGAACTTTGATGGTAATACTGTGCGTTATTCCCATGGTCCCGTAACGCCAGCCTTCTTTAAATGGCCGG
GTTTACGTCAAGGCACCATTGTCAGTTTAACGGCCCAACGCCAGAAGGCATCCGCGATGCCCGATATTCT
TTTTCGCGGACCTTGGGCACTCTTGCAGTGGGCTGATCAGGCCGATGAAATTCGCGATGAAGCGAATGGC
AAACAGACGCTGACTTATCTCATGGGGAAAGATCGTGTCGAGCTTGAAGTCTCAGGTTTAACGCATGGTG
GTGAAACCATTAGCGATCTGCTGAGAGATTTCAAATGCCCCAGTGTCAATGACATGAATGGTATTTGGTA
A
 Primer design