SecReT6
Protein ID: 162421893
SecReT6 ID244
T6SS typeN/A
Gene symbolicmF
Locus tagYpAngola_A1937
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]2007918..2011370 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDA9R772
KEGG IDypg:YpAngola_A1937
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.80E-84, Aligned region: 584..899
ImcF-related_N [PF14331], Evalue: 4.10E-72, Aligned region: 251..536
DUF1215 [PF06744], Evalue: 8.60E-30, Aligned region: 626..647
DUF1215 [PF06744], Evalue: 8.60E-30, Aligned region: 1014..1127
Protein Sequence: 1150 a.a.     [Download]
>gi|162421893|ref|YP_001606411.1| type VI secretion protein IcmF [Yersinia pestis Angola]
MSYLNRLFSGWAMKRILLVGCFILLAAAIWFLGPFLGFGEARPLESYEARIICILLALLLILGFWYGAPR
FVIAAVVACAAVWVIGPFILVGDDHPLTDGIRRGIIIAIIAFITLIYGTWCLVKALAKNPALLDNFIKHK
KAAKPEAEAELSEVNAMIRNGMNYVRRIHSGIPAWRRFFISNRWRTELPWFMVVGMKGAGKTALILSSGQ
DFPLPEQLNRIGKENPPTQHCECLFSNDALFLDTSGKYIDDSKDNQTEWTGILKALKKYRPVKAINGVIV
AISASDILGKSKADLLNVSATLRTRLDEVRAVLGVRFPVYVTITKLDQISGFDEYFRNLTAEDREQIWGV
TFPYNEAKEQSDMPLQQRISHELALLEDRISNNMHVRQQEEYAVADRKGMYALPQDFRMLSQRVTEVLQN
VFFASRFDETKFHTTLRGIYFVSSCQPADVELLNNNTLIQKWRNVINHKKPLSPADLSQKSDNEDRFISD
VAYGKQYFLKQLFSDVITKDADLVSYNLKVQSKYRFQNLLGHAACIGLAVWLVWAFLVSFQHNEGYLQAT
GAKLSQLESTVMSYAKTSNEQILPALLNATQQLPEYGTLDVANPELDWRYGLYTGSAISQGANTLYQFFL
QKYLFPMVENQSEVTLRKTMHSGQSEEVYAALKLYLMLTGEGKFDRQYMIEHVTQDWQKSGKIEPYEEKS
IFVGHLNTLFTLKDWRQYGQPADSELIKQARAILAEKTVTARLWGRIQSRLLADAPANMTLRKMVGEHAT
QVFTLSDDELLHEGIPGLYTYAGYHEVVKKKLTPLLMLLQEEDRWVMAQSLSSSLDPLTLRQDVLVMYLQ
GYAAYWKRFLSSVRLISVDADSAEYAQGLSLDIALLRTLVSENSPLLNLARQAVKETTLAEKEKAITDEI
NIRTQGQLLSQAKKLQETIAFRENKLIKEWVDNRFESLRVFVNGEQSADVTGGNNLSVLQGTQMSRIIGT
LNDQYTRFVVYNSAFEYGDIPPLSQDGERIAVESQTWPDPFRNIIAPLLTGSSQKFENKVITHTSKAIDM
GVGEICRNTLQGRYPFAESEQIVSLNDFERFFGTDGTVDSYFKKNLESKVDTSSIPWRYKGSVSSEGLAF
FEQAAMIRNVLFNTNDGKKMALDEPVHNSV
 
Nucleotide Sequence: 3453 bp     [Download]
>gi|162418099|ref|NC_010159.1|:c2011370-2007918 Yersinia pestis Angola chromosome, complete genome
ATGTCTTATTTGAATCGATTGTTTTCTGGCTGGGCCATGAAACGCATATTGCTGGTCGGCTGCTTTATAT
TGCTGGCTGCGGCGATATGGTTTCTGGGGCCTTTCCTCGGCTTTGGTGAGGCGCGGCCTCTCGAAAGTTA
TGAAGCCAGAATTATTTGCATCCTGCTGGCACTGCTGCTGATCTTAGGTTTTTGGTACGGCGCACCGCGC
TTTGTCATTGCCGCCGTCGTTGCCTGTGCTGCGGTATGGGTGATTGGCCCATTCATATTAGTTGGTGATG
ATCATCCTCTGACTGATGGGATCCGTCGCGGCATCATTATCGCCATCATTGCATTTATTACACTTATTTA
TGGCACCTGGTGCTTAGTCAAAGCATTGGCGAAAAATCCAGCGTTACTGGATAACTTCATTAAGCACAAG
AAAGCGGCCAAGCCTGAAGCGGAGGCTGAACTTTCTGAAGTTAATGCGATGATCCGCAATGGCATGAACT
ATGTGCGCCGTATTCACAGTGGTATTCCGGCCTGGCGACGTTTCTTTATCTCCAACCGTTGGCGCACAGA
ACTGCCTTGGTTCATGGTTGTCGGTATGAAAGGTGCAGGGAAAACCGCCCTTATCCTCTCTTCAGGACAG
GACTTTCCTTTACCTGAGCAGCTGAATCGTATTGGCAAAGAAAACCCACCCACTCAACATTGTGAATGTT
TGTTCTCTAATGACGCCCTGTTTTTAGACACTTCAGGGAAATACATTGATGACAGCAAAGATAATCAGAC
TGAGTGGACCGGGATATTAAAGGCACTCAAAAAATATCGTCCGGTTAAGGCAATTAATGGTGTCATTGTT
GCGATTTCGGCATCCGATATCTTGGGTAAAAGTAAAGCTGATTTACTGAATGTGTCGGCGACGCTACGCA
CGCGTTTGGATGAGGTACGTGCGGTCTTGGGCGTCCGTTTCCCGGTGTATGTCACGATTACAAAACTGGA
TCAAATATCGGGTTTTGATGAATATTTCCGTAATTTAACGGCTGAAGATCGCGAGCAAATTTGGGGGGTG
ACTTTCCCTTATAACGAGGCGAAAGAGCAATCCGATATGCCACTTCAGCAACGTATCAGCCATGAGCTGG
CACTGCTTGAGGATCGTATCAGCAATAATATGCACGTCCGCCAGCAGGAAGAGTATGCCGTGGCGGACAG
AAAAGGCATGTATGCACTCCCTCAGGATTTCAGGATGCTCTCCCAGAGGGTAACGGAAGTTTTACAGAAT
GTTTTCTTCGCCTCACGCTTTGACGAAACAAAATTTCACACGACCCTGAGAGGGATCTATTTTGTCAGCA
GTTGTCAGCCTGCGGATGTTGAACTGTTAAATAACAACACGCTGATTCAAAAGTGGCGTAACGTTATTAA
TCATAAAAAACCGTTATCGCCAGCCGATTTATCACAAAAAAGTGATAATGAAGATCGGTTTATTAGCGAT
GTGGCTTACGGGAAACAATATTTCCTCAAGCAGTTGTTTAGCGATGTGATTACCAAAGATGCCGACTTAG
TCAGCTATAACCTGAAAGTACAATCCAAATACCGTTTTCAGAATCTATTGGGACACGCGGCTTGTATTGG
GTTGGCAGTTTGGCTGGTTTGGGCCTTCTTGGTCAGCTTCCAGCATAACGAGGGGTATTTACAGGCGACC
GGTGCCAAGCTGAGTCAGTTAGAAAGCACGGTGATGAGTTATGCCAAAACGTCCAATGAGCAGATCTTAC
CTGCGTTATTGAACGCGACACAGCAGTTACCCGAGTACGGTACGCTGGATGTGGCTAACCCTGAGCTTGA
CTGGCGTTATGGCTTATATACCGGTAGCGCAATCTCACAAGGTGCGAACACGCTCTATCAGTTTTTCTTG
CAAAAATATCTCTTCCCAATGGTTGAGAATCAGAGTGAGGTTACATTAAGAAAAACGATGCACTCAGGTC
AGAGCGAAGAGGTTTATGCCGCGCTGAAGCTTTATTTGATGCTGACGGGTGAAGGTAAATTTGATCGTCA
ATATATGATTGAGCACGTGACCCAAGATTGGCAGAAAAGTGGAAAAATTGAGCCTTACGAAGAGAAGAGT
ATTTTCGTCGGTCATTTGAACACGCTGTTTACCCTGAAAGACTGGCGGCAGTATGGGCAACCGGCAGACA
GTGAACTGATTAAGCAGGCTCGGGCAATACTGGCGGAAAAAACAGTGACCGCCAGACTTTGGGGGCGTAT
TCAATCCCGCTTATTGGCCGATGCCCCTGCCAATATGACGTTACGTAAAATGGTGGGTGAGCACGCGACA
CAGGTATTCACCCTGTCAGATGATGAACTACTGCATGAAGGGATCCCGGGGCTTTATACCTACGCGGGCT
ACCATGAGGTGGTTAAAAAAAAACTGACACCTTTGCTGATGTTACTTCAGGAAGAGGATAGGTGGGTGAT
GGCGCAATCGCTGTCATCTTCTCTTGACCCCCTGACGTTAAGACAAGATGTTCTGGTGATGTATTTACAA
GGGTATGCCGCTTATTGGAAACGCTTTCTCTCCAGTGTTCGTCTGATTTCTGTCGATGCGGACAGTGCAG
AGTATGCTCAAGGGCTGTCTCTGGATATTGCTTTGTTAAGGACGTTAGTTTCAGAAAATTCACCGCTACT
CAATTTAGCCAGGCAGGCGGTAAAAGAAACGACACTCGCCGAAAAAGAAAAAGCCATTACTGATGAGATA
AACATCAGAACGCAAGGGCAATTACTCAGCCAGGCTAAAAAATTACAAGAAACGATCGCGTTTCGTGAAA
ATAAACTGATTAAAGAGTGGGTTGATAATCGTTTTGAATCCCTGAGAGTCTTTGTTAATGGGGAACAGAG
TGCTGATGTCACGGGGGGCAATAATCTTTCTGTTCTTCAGGGAACGCAGATGAGCCGAATAATCGGGACA
TTAAACGATCAATATACCCGTTTTGTTGTTTATAACAGTGCCTTTGAATATGGCGATATTCCTCCGTTAT
CCCAGGATGGGGAACGTATTGCGGTGGAATCACAAACATGGCCGGATCCGTTTAGAAATATTATTGCACC
GTTATTAACGGGCTCATCCCAGAAATTTGAAAATAAAGTGATTACTCACACGTCCAAAGCGATTGATATG
GGGGTGGGGGAAATTTGCCGGAATACGCTGCAAGGGCGTTACCCATTTGCTGAAAGTGAGCAAATTGTTA
GTTTGAATGATTTTGAGCGTTTCTTCGGTACTGACGGTACGGTGGACAGTTATTTCAAGAAAAACTTGGA
GAGTAAAGTCGACACGTCCTCAATACCTTGGCGTTATAAGGGCAGCGTAAGTAGTGAAGGTTTGGCGTTC
TTTGAACAGGCGGCAATGATCAGAAACGTGCTATTTAATACCAATGACGGTAAAAAAATGGCATTAGATG
AGCCTGTCCATAATTCTGTGTAA
 Primer design